| PDBID: | 9cy5 | | Status: | HPUB -- hold until publication | | Title: | Dyrk1a bound to a competitive inhibitor | | Authors: | Montfort, W.R. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cy2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cy1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cy6 | | Status: | PROC -- to be processed | | Title: | Crystal structure of IgG1 FC M252H at pH 7.5 | | Authors: | Reddem, E.R., Shapiro, L. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cya | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | C387S variant of D-ornithine/D-lysine decarboxylase complexed with HEPES and putrescine | | Authors: | Phillips, R.S., Blankenship, S. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cxy | | Status: | PROC -- to be processed | | Title: | Crystal structure of SARS-CoV-2 NSP3 macrodmain in complex with AVI-1500 | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cxz | | Status: | PROC -- to be processed | | Title: | Crystal structure of SARS-CoV-2 NSP3 macrodmain in complex with AVI-1501 | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cy0 | | Status: | PROC -- to be processed | | Title: | Crystal structure of SARS-CoV-2 NSP3 macrodomain in complex with AVI-4206 | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cyb | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cy3 | | Status: | HPUB -- hold until publication | | Title: | Outward-facing Atorvastatin-bound OATP1B1 with sybody Sb5 | | Authors: | Sung, M.W., Lees, J.A., Han, S. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cy4 | | Status: | HPUB -- hold until publication | | Title: | Outward-facing cyclosporine A-bound OATP1B1 with sybody 5 (Sb5) | | Authors: | Sung, M.W., Lees, J.A., Han, S. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cy8 | | Status: | HPUB -- hold until publication | | Title: | Constrained b-hairpins targeting the EphA4 ligand binding domain | | Authors: | Muzzarelli, K.M., Assar, Z., Prentis, A.M., Baggio, C., Pellecchia, M. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cyc | | Status: | PROC -- to be processed | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gcg | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gcb | | Status: | HPUB -- hold until publication | | Title: | Structure of IsDUF4198 | | Authors: | Franco Cairo, J.P.L., Correa, T.L.R., Offen, W.A., Nairn, A., Walton, J., Davies, G.J., Walton, P.H. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gce | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gc2 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of Arabidopsis thaliana PSI-LHCI- a603-NH mutant | | Authors: | Capaldi, S., Chaves-Sanjuan, A., Bonnet, D.M.V., Bassi, R. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gc7 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gc4 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Highly optimized CNS penetrant inhibitors of EGFR Exon20 Insertion Mutations | | Authors: | Hargreaves, D. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gc5 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Highly optimized CNS penetrant inhibitors of EGFR Exon20 Insertion Mutations | | Authors: | Hargreaves, D. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gch | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human mitochondrial RNAseZ with tRNA-His-CCA | | Authors: | Valentin Gese, G., Hallberg, B.M. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gc1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH COMPOUND8 | | Authors: | Schaefer, M., Fuerstner, C. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gc3 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gc6 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Highly optimized CNS penetrant inhibitors of EGFR Exon20 Insertion Mutations | | Authors: | Hargreaves, D. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gc8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Pseudomonas aeruginosa IspD in complex with C11H12N2O3 | | Authors: | Borel, F., D''Auria, L. | | Deposition date: | 2024-08-01 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMTTSDLPAFWTVIPAAGVGSRMRADRPKQYLDLAGRTVIERTLDCFLEHPMLRGLVVCLAEDDPYWPGLDCAASRHVQRAAGGAERAGSVLNGLLRLLELGAQADDWVLVHDAARPNLTRGDLDRLLEELAEDPVGGLLAVPARDTLKRSDRDGRVSETIDRSVVWLAYTPQMFRLGALHRALADALVAGVAITDEASAMEWAGYAPKLVEGRADNLKITTPEDLLRLQRSFPHLE
|
|
