PDBID: | 8yy9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 8yy7 | Status: | HPUB -- hold until publication | Title: | Crystal structure of PtmB in complex with cyclo-(L-Trp-L-Trp) and Hypoxanthine | Authors: | Zhang, Z.Y., Qu, X.D., Duan, B.R., Wei, G.Z. | Deposition date: | 2024-04-03 |
|
PDBID: | 8yy0 | Status: | HPUB -- hold until publication | Title: | Vo domain of V/A-ATPase from Thermus thermophilus state2 | Authors: | Kishikawa, J., Nishida, Y., Nakano, A., Yokoyama, K. | Deposition date: | 2024-04-03 |
|
PDBID: | 8yye | Status: | HPUB -- hold until publication | Title: | Crystal structure of lipase CTL (Caldibacillus Thermoamylovorans) | Authors: | Pan, S.Y., Lan, D.M., Wang, Y.H. | Deposition date: | 2024-04-03 |
|
PDBID: | 8yyd | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 8yy6 | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2024-04-03 |
|
PDBID: | 8yxv | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9ew0 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9ewi | Status: | HPUB -- hold until publication | Title: | Dye-decolourising peroxidase DtpB (168 kGy) | Authors: | Lucic, M., Worrall, J.A.R., Hough, M.A., Owen, R.L., Strange, R.W. | Deposition date: | 2024-04-03 |
|
PDBID: | 9ewd | Status: | HPUB -- hold until publication | Title: | DNA Polymerase Lambda I493K E529D, TTP:At Ca2+ Ground State Ternary Complex | Authors: | Nourisson, A., Haouz, A., Missoury, S., Delarue, M. | Deposition date: | 2024-04-03 |
|
PDBID: | 9ba1 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9b9p | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 | Sequence: | >Entity 1 MTTVYYDQDVKTDALQGKKIAVVGYGSQGHAHAQNLKDNGYDVVIGIRPGRSFDKAKEDGFDVFPVAEAVKQADVIMVLLPDEIQGDVYKNEIEPNLEKHNALAFAHGFNIHFGVIQPPADVDVFLVAPKGPGHLVRRTFVEGSAVPSLFGIQQDASGQARNIALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGVSKLIQSGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGMENVRYSISNTAEFGDYVSGPRVITPDVKENMKAVLTDIQNGNFSNRFIEDNKNGFKEFYKLREEQHGHQIEKVGRELREMMPFIKSKSIEKHHHHHH
|
|
PDBID: | 9ba0 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9b9q | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9b9x | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9b9t | Status: | HPUB -- hold until publication | Title: | Crystal structure of the ternary complex of DCAF1 and WDR5 with PROTAC, OICR-40407 | Authors: | Mabanglo, M.F., Hoffer, L., Al-awar, R., Vedadi, M. | Deposition date: | 2024-04-03 |
|
PDBID: | 9b9w | Status: | HPUB -- hold until publication | Title: | Crystal structure of the ternary complex of DCAF1 and WDR5 with PROTAC, OICR-40792 | Authors: | Mabanglo, M.F., Hoffer, L., Al-awar, R., Vedadi, M. | Deposition date: | 2024-04-03 |
|
PDBID: | 9ba2 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the binary complex of DCAF1 and WDR5 | Authors: | Mabanglo, M.F., Vedadi, M., Al-awar, R. | Deposition date: | 2024-04-03 |
|
PDBID: | 9ba3 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9ba8 | Status: | AUTH -- processed, waiting for author review and approval | Title: | O-GlcNAcase (OGA) inhibitor complex for the Treatment of Alzheimer''s Disease | Authors: | Hendle, J. | Deposition date: | 2024-04-03 |
|
PDBID: | 9bab | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM of Hyper2 tube, ~27 nm diameter | Authors: | Sonani, R.R., Miller, J.G., Conticello, V., Egelman, E.H. | Deposition date: | 2024-04-03 | Release date: | 2025-04-03 |
|
PDBID: | 9ba6 | Status: | HPUB -- hold until publication | Title: | High-resolution crystal structure of Vibrio cholerae NFeoB in the apo form | Authors: | Lee, M., Smith, A.T. | Deposition date: | 2024-04-03 |
|
PDBID: | 9bac | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM of Hyper2 tube, ~24 nm diameter | Authors: | Sonani, R.R., Miller, J.G., Conticello, V., Egelman, E.H. | Deposition date: | 2024-04-03 | Release date: | 2025-04-03 |
|
PDBID: | 9ba7 | Status: | HPUB -- hold until publication | Title: | Crystal structure of Vibrio cholerae N150T NFeoB variant with a single GDP molecule bound | Authors: | Lee, M., Smith, A.T. | Deposition date: | 2024-04-03 |
|
PDBID: | 9ba9 | Status: | AUTH -- processed, waiting for author review and approval | Title: | O-GlcNAcase (OGA) inhibitor complex for the Treatment of Alzheimer''s Disease | Authors: | Hendle, J. | Deposition date: | 2024-04-03 |
|