| PDBID: | 9oip | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9oiu | | Status: | HPUB -- hold until publication | | Title: | Soltion Structure of His6-Small Ubiquitin-like Modifier (His6-SUMO) | | Authors: | Mallett, T.M., Lamer, T.D., Vederas, J.C. | | Deposition date: | 2025-05-06 | | Sequence: | >Entity 1
MGSSHHHHHHGSGLVPRGSASMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG
|
|
| PDBID: | 9ois | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of glycosyltransferase family 61 from Sorghum bicolor | | Authors: | Pereira, J.H., Wang, H.T., DeGiovanni, A.M., Scheller, H.V., Adams, P.D. | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9oiv | | Status: | HPUB -- hold until publication | | Title: | Structure of Undecaprenyl diphosphate synthase (UPPS) from Neisseria gonorrohea soaked with 4W-0801 | | Authors: | Santiago, A.S., Llontop, E.E., Amaral, B.S., Ramos, P.Z., Piccirillo, E., Almeida, V.M., Barreiro, G., Massirer, K.B., Counago, R.M. | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9oiw | | Status: | HPUB -- hold until publication | | Title: | Structure of Undecaprenyl diphosphate synthase (UPPS) from Neisseria gonorrohea soaked with GF-0701 | | Authors: | Santiago, A.S., Llontop, E.E., Amaral, B.S., Ramos, P.Z., Piccirillo, E., Almeida, V.M., Barreiro, G., Massirer, K.B., Counago, R.M. | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9oiy | | Status: | HPUB -- hold until publication | | Title: | Structure of Undecaprenyl diphosphate synthase (UPPS) from Neisseria gonorrohea soaked with DA-0841 | | Authors: | Santiago, A.S., Llontop, E.E., Amaral, B.S., Ramos, P.Z., Piccirillo, E., Almeida, V.M., Barreiro, G., Massirer, K.B., Counago, R.M. | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9oj1 | | Status: | HPUB -- hold until publication | | Title: | Structure of Undecaprenyl diphosphate synthase (UPPS) from Neisseria gonorrohea soaked with DA-0854 | | Authors: | Santiago, A.S., Llontop, E.E., Amaral, B.S., Ramos, P.Z., Piccirillo, E., Almeida, V.M., Barreiro, G., Massirer, K.B., Counago, R.M. | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9oj0 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-05-06 | | Release date: | 2026-05-06 |
|
| PDBID: | 9oi3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9oi9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9oij | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9oik | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9oix | | Status: | HPUB -- hold until publication | | Title: | Co-Structure of Main Protease of SARS-CoV-2 with NVP-EGT710 | | Authors: | Knapp, M.S., Ornelas, E. | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9oiz | | Status: | HPUB -- hold until publication | | Title: | Co-Structure of Main Protease of SARS-CoV-2 with Compound 11 | | Authors: | Knapp, M.S., Ornelas, E. | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9r3s | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9r3x | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9r3t | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9r40 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-05-06 | | Release date: | 2026-05-06 |
|
| PDBID: | 9r3v | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9r3r | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF LYSYL-TRNA SYNTHETASE FROM Cryptosporidium parvum COMPLEXED WITH L-LYSINE AND INHIBITOR DDD01827593 | | Authors: | Dawson, A., Baragana, B., Forte, B., Robinson, D.A. | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9r3w | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9r3u | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9r3z | | Status: | HOLD -- hold until a certain date | | Title: | Exploiting ALDH1A2 and ALDH1A3 Isoform Variability for Crystallization Screening | | Authors: | Garaavglia, S., Mazzorana, M. | | Deposition date: | 2025-05-06 | | Release date: | 2026-05-06 |
|
| PDBID: | 9r3y | | Status: | HPUB -- hold until publication | | Title: | Solution NMR structure of N-WASP GBD in complex with EspFu R5 | | Authors: | Tossavainen, H., Permi, P. | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9uu3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-05 |
|
