PDBID: | 8y68 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8y67 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8y6e | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-02-02 |
|
PDBID: | 8y69 | Status: | HPUB -- hold until publication | Title: | LGR4-RSPO2-ZNRF3 (2:2:2) | Authors: | Wang, L. | Deposition date: | 2024-02-02 |
|
PDBID: | 8y6l | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8y6m | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8y6n | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8rvx | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8rvy | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-02-02 |
|
PDBID: | 8rw1 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-02-02 |
|
PDBID: | 8rvw | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8rw0 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the adenosine A2A receptor in complex with Istradefylline | Authors: | Glover, H. | Deposition date: | 2024-02-02 |
|
PDBID: | 8rw4 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8rw7 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8rwc | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8rvr | Status: | HPUB -- hold until publication | Title: | Crystal structure of Trypanosoma congolense pyruvate kinase in complex with a single-domain antibody (TcoPYK-sdAb42) in the presence of sulfate | Authors: | Sterckx, Y.G.-J. | Deposition date: | 2024-02-02 |
|
PDBID: | 8rw9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 | Sequence: | >Entity 1 QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYPMSWVRQAPGKGLEWVSDINSSGTTYYADSVKGRFTISRDNAKNTLYLQMNSLKPEDTAVYYCATEGKYGRTWYGQLEYHYWGQGTQVTVSEHHHHHH
>Entity 2 MHHHHHHESAKAVTTQKVEVKFSKAVEKLTKEDIKVTNKANNDKVLVKEVTLSEDKKSATVELYSNLAAKQTYTVDVNKVGKTEVAVGSLEAKTIEMADQTVVADEPTALQFTVKDENGTEVVSPEGIEFVTPAAEKINAKGEITLAKGTSTTVKAVYKKDGKVVAESKEVKVSAE
|
|
PDBID: | 8rvz | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8rw6 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8rw5 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8rw8 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8rwb | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8rvu | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8vwh | Status: | HPUB -- hold until publication | Title: | Structure of the baculovirus major nucleocapsid protein VP39 (localised reconstruction) | Authors: | Johnstone, B.A., Hardy, J.M., Ha, J.H., Venugopal, H., Coulibaly, F. | Deposition date: | 2024-02-01 |
|
PDBID: | 8vwj | Status: | HPUB -- hold until publication | Title: | The base complex of the AcMNPV baculovirus nucleocapsid (Class 2, localised reconstruction) | Authors: | Johnstone, B.A., Koszalka, P., Ha, J., Venugopal, H., Coulibaly, F. | Deposition date: | 2024-02-01 |
|