| PDBID: | 9jxx | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SiRe_0806 in complex with cA4 | | Authors: | Wang, F., Zhao, P., Bi, X., She, Q. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9jxv | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9jxy | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Small GTPase RhoA C16R mutant in complex with GTP analogue | | Authors: | Zu, S., Wu, H. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9jym | | Status: | HPUB -- hold until publication | | Title: | YdiU complexed with NAD and Mn2+ | | Authors: | Liu, K., Zhang, T., Wang, T., Xiang, S. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9jyn | | Status: | HPUB -- hold until publication | | Title: | YdiU complexed with NAD | | Authors: | Liu, K., Zhang, T., Wang, T., Xiang, S. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9jyo | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-10-12 | | Release date: | 2025-10-12 |
|
| PDBID: | 9jyp | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-10-12 | | Release date: | 2025-10-12 |
|
| PDBID: | 9jyr | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-10-12 | | Release date: | 2025-10-12 |
|
| PDBID: | 9jys | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-10-12 | | Release date: | 2025-10-12 |
|
| PDBID: | 9jyv | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-10-12 | | Release date: | 2025-10-12 |
|
| PDBID: | 9dy1 | | Status: | HPUB -- hold until publication | | Title: | Human PDK1 kinase domain in complex with N6-Methyladenine | | Authors: | Gross, L.Z.F., Klinke, S., Biondi, R.M. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9dxz | | Status: | HPUB -- hold until publication | | Title: | Human PDK1 kinase domain in complex with N6-Methyladenosine | | Authors: | Gross, L.Z.F., Klinke, S., Biondi, R.M. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9dy2 | | Status: | HPUB -- hold until publication | | Title: | Human PDK1 kinase domain in complex with 2''-Deoxyadenosine | | Authors: | Gross, L.Z.F., Klinke, S., Biondi, R.M. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9dxy | | Status: | HPUB -- hold until publication | | Title: | Human PDK1 kinase domain in complex with ADP | | Authors: | Gross, L.Z.F., Klinke, S., Biondi, R.M. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9dy0 | | Status: | HPUB -- hold until publication | | Title: | Human PDK1 kinase domain in complex with N6-Dimethyladenine | | Authors: | Gross, L.Z.F., Klinke, S., Biondi, R.M. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9dxx | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the A/Puerto Rico/8/1934 (H1N1) influenza virus hemagglutinin in complex with D-peptide | | Authors: | Kadam, R.U., Wilson, I.A. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9dy3 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of C4-Dicarboxylate-Binding Periplasmic Protein (PA5167) of Tripartite ATP-independent Periplasmic Transporter Family from Pseudomonas aeruginosa PAO1 in Complex with L-Malate | | Authors: | Minasov, G., Shukla, S., Shuvalova, L., Satchell, K.J.F., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2024-10-12 | | Sequence: | >Entity 1
SNAADPIVIKFSHVVAEHTPKGQGALLFKKLVEERLPGKVKVEVYPNSSLFGDGKE(MSE)EALLLGDVQIIAPSLAKFEQYTKKLQIFDLPFLFDNIQAVDRFQQSPQGKELLTS(MSE)QDKGITGLGYWHNG(MSE)KQLSANKPLREPKDARGLKFRVQASKVLEEQFKAVRANPRK(MSE)SFAEVYQGLQTGVVNGTENPWSNIYSQK(MSE)HEVQKYITESDHGVLDY(MSE)VITNTKFWNGLPEDVRGVLAKT(MSE)DEVTVEVNKQAEALNQGDKQRIVEAKTSEIIELTPEQRAEWRKA(MSE)QPVWKKFEGEIGADLIKAAEAANQAQ
|
|
| PDBID: | 9h2i | | Status: | HPUB -- hold until publication | | Title: | Dihydrolipoyl Dehydrogenase (E3) in complex with the binding domain of Dihydrolipoamide Acetyltransferase (E2) from the E. coli pyruvate dehydrogenase complex | | Authors: | Bothe, S.N., Zajec Hudnik, T., Glockshuber, R. | | Deposition date: | 2024-10-11 |
|
| PDBID: | 9h2f | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-10-11 |
|
| PDBID: | 9h26 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of rsCherry exposed to oxygen for 69 days | | Authors: | Bui, T.Y.H., Van Meervelt, L. | | Deposition date: | 2024-10-11 |
|
| PDBID: | 9h27 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of rsCherry exposed to oxygen for 90 days | | Authors: | Bui, T.Y.H., Van Meervelt, L. | | Deposition date: | 2024-10-11 |
|
| PDBID: | 9h25 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of rsCherry exposed to oxygen for 16 days | | Authors: | Bui, T.Y.H., Van Meervelt, L. | | Deposition date: | 2024-10-11 |
|
| PDBID: | 9h2a | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-11 |
|
| PDBID: | 9h2d | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human IFT172 C-terminal U-box domain crystal structure | | Authors: | Lorentzen, E., Zacharia, N.K., Bhogaraju, S. | | Deposition date: | 2024-10-11 |
|
| PDBID: | 9h2b | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-11 |
|
