| PDBID: | 8upg | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8upj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8upa | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8wv0 | | Status: | HPUB -- hold until publication | | Title: | Outer membrane porin of Burkholderia pseudomallei (BpsOmp38) | | Authors: | Bunkum, P., Aunkham, A., Bert van den, B., Robinson, R.C., Suginta, W. | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8wv1 | | Status: | HPUB -- hold until publication | | Title: | Ambient Temperature Structure of 50S Ribosomal Subunit from Thermus Thermophilus | | Authors: | DeMirci, H., Tosun, B. | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8wuz | | Status: | HPUB -- hold until publication | | Title: | Development of 2-imino-2,3,5,6,7,8-hexahydropyrido[4,3-d]pyrimidin-4(1H)-one derivatives as human caseinolytic peptidase P (hClpP) activators | | Authors: | Jiang, J.-X., Ding, H., Chen, M.-R., Lu, M.-L., Sun, H.-Y., Xiao, Y.-B. | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8wv2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-22 | | Sequence: | >Entity 1
MLTDNWKELAGKAQSTFQKSLKQAIELADFDEGLAKRYGALPSAIGANVEDFGSPAQFPLEEYLKALPKKVLDITEKDPVELLKDLKSRKVTCVEVLKAYTAASIVASKLTNCVQEFLPIEALQYAQKLDADYETKKHLPLYGLPFSIKEMIPFVGRSVTHGSLCYLDRIVDYNADIVNILIANGAYPFVRTTNPQSLMMLECVSFSHGRTVNAYNGMLTSGGSSGGEGALNGMRASPFGLGSDIGGSIRCPAAFNGIYGLRSTLGRIPTADYFSCNRGSESILSVTGPLSRSLDTVNLVMKTVIEAKPWLIDPTLVPLDWKRPENKKFRVGIYVSDHIVNPSPPINRALSMVTEKLKSLGNFEVVTFEPYKPEKVTEILGKLYFEDGARDFRATLQTGEPLLEQTRWAIEGAEDLDMHDQWYWNLQKQAYRKEFLKHWCSYTDNDGNVLDAVIAPVFPNVAAKHETTKYWTYTSQWNLLDYPVLAFPVTKVDESLDQPYKNYKPLNDLDKYFYEQYDSPSSFKNAPANLCLVGLRFTDEKLVEIANILRN
|
|
| PDBID: | 8qx3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-21 |
|
| PDBID: | 8up5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-21 |
|
| PDBID: | 8wur | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of SARS-Cov-2 main protease D48N mutant in complex with shikonin | | Authors: | Zhao, Z.Y., Li, W.W., Zhang, J., Li, J. | | Deposition date: | 2023-10-21 | | Release date: | 2024-10-21 |
|
| PDBID: | 8wuj | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of A. thaliana H2A.W nucleosome | | Authors: | Liu, X., Gong, Q.Y. | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8wu9 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human canonical nucleosome | | Authors: | Liu, X., Gong, Q.Y. | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8qx1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8qww | | Status: | HPUB -- hold until publication | | Title: | Structure of the amyloid-forming peptide LYIQWL from Tc5b, grown from 10% ethanol without TFA | | Authors: | Durvanger, Z. | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8qwv | | Status: | HPUB -- hold until publication | | Title: | Structure of the amyloid-forming peptide LYIQNL, grown in the presence of ethanol | | Authors: | Durvanger, Z. | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8qwu | | Status: | HPUB -- hold until publication | | Title: | Structure of the amyloid-forming peptide LYIQNL, grown without ethanol | | Authors: | Durvanger, Z. | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8up2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8uot | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8uoq | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8uom | | Status: | HPUB -- hold until publication | | Title: | LSD1-CoREST with N-formyl-FAD in complex with H3dimeK4 histone tail | | Authors: | Caroli, J., Mattevi, A. | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8uon | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8uos | | Status: | HPUB -- hold until publication | | Title: | Designed IL1-R antagonist BB73 | | Authors: | Jude, K.M., Garcia, K.C. | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8up4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8up1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8up0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-20 |
|
