| PDBID: | 8qib | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qhv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qhw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qhx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qhz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi0 | | Status: | HPUB -- hold until publication | | Title: | 340A Vipp1 H1-6 helical tubes | | Authors: | Junglas, B., Sachse, C. | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi4 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qia | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qhy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8u4y | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of SARS-CoV-2 Main Protease (Mpro) L50F Mutant | | Authors: | Kohaal, N., Lewandowski, E.M., Wang, J., Chen, Y. | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8u52 | | Status: | HPUB -- hold until publication | | Title: | Co-crystal structure of human transthyretin conjugated to the stilbene substructure derived from reaction with the fluorogenic covalent kinetic stabilizer A2 | | Authors: | Yan, N.L., Nugroho, K., Kline, G.M., Basanta, B., Lander, G.C., Wilson, I.A., Kelly, J.W. | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8u4x | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of PsBphP in Pr state | | Authors: | Basore, K., Burgie, E.S., Vierstra, D. | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8wc2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8wc0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of EcThsA | | Authors: | Chen, Q., Yu, Y. | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8wbz | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-09-10 |
|
| PDBID: | 8wbw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-10 |
|
| PDBID: | 8qht | | Status: | HPUB -- hold until publication | | Title: | Leishmania braziliensis PRMT1-PRMT3 heterotetrameric complex in unliganded form. | | Authors: | Levdikov, V., Nay, E., Walrad, P., Plevin, J.M. | | Deposition date: | 2023-09-10 | | Sequence: | >Entity 1
DYYFDSYSHYGIHMEMLKDYHRTTTYRDAIWRNAYMFKDKVVLDVGCGTGILSMFAARAGARKVIGIDCSNVAVQARQIVQDNGFSDIITIIQGKVEELDLDEKVDIIISEWMGYFLLYESMLNTVLYARDRWGASDVKILPSSANMYACGITDPQYVEQKFNIWNSVNGLDFSYFKRLSYIEPLIDTVNPEQIITDIVPFFSFDINRVTEAELSFTSTFTLEAKQGDFVHAISVHFDTPFYAGHDPVVLNTSPMVPPTHWRQTVLYMFHPLIMKRGEKANFTMKCAPNPGNPRDLDISLHIDFDGELQACHYDQDFRLR
>Entity 2
SAARISSNISTIHDHQRLRAYEVIFRNVRGKTLLHLGCGMGLYSMLAARGMAKMVIGIDSSAIVDAARVVAEQNGLKNIQFIRGRLCEALHQLPSDMKFDYVLCEWMGPLLLNERVLTDALYARDHLLTESGALCPNRASLHVVAVSDYAFRLDTEDFWSNVYGFQMEPMKELVRQEVEMCAIPGSNIVSAPCLAHTIHMDTLEGLTAEETATYEAQANQAAAIRDNEEENPVEHCWVPAAVAQKGYEAAFTLSIARSATVHYLTFYLDAAFTSKTNPGANFVLAVRPGGQNNWTEVSVGLREPLPVNAGEKIQGTVRVYTPAEKGGKVTVVEVTAKTAGQVAAIETFGTYYYQSY
|
|
| PDBID: | 8qhu | | Status: | HPUB -- hold until publication | | Title: | CRYO-EM STRUCTURE OF LEISHMANIA MAJOR 80S RIBOSOME : LM32Cs1C1 snoRNA overexpression | | Authors: | Rajan, K.S., Yonath, A., Bashan, A. | | Deposition date: | 2023-09-10 |
|
| PDBID: | 8u4h | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-10 |
|
