PDBID: | 9l68 | Status: | HPUB -- hold until publication | Title: | Crystal structure of human STING in complex with F8W | Authors: | Feng, Z.W., Zeng, T., Chen, M.R., Xiao, Y.B., Xu, X.L. | Deposition date: | 2024-12-24 |
|
PDBID: | 9l6d | Status: | HPUB -- hold until publication | Deposition date: | 2024-12-24 |
|
PDBID: | 9l63 | Status: | HPUB -- hold until publication | Title: | A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures | Authors: | Jiang, J., Fang, P. | Deposition date: | 2024-12-24 |
|
PDBID: | 9l64 | Status: | HPUB -- hold until publication | Title: | A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures | Authors: | Jiang, J., Fang, P. | Deposition date: | 2024-12-24 |
|
PDBID: | 9l65 | Status: | HPUB -- hold until publication | Title: | A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures | Authors: | Jiang, J., Fang, P. | Deposition date: | 2024-12-24 |
|
PDBID: | 9l6e | Status: | HPUB -- hold until publication | Title: | A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures | Authors: | Jiang, J., Fang, P. | Deposition date: | 2024-12-24 |
|
PDBID: | 9l6a | Status: | HPUB -- hold until publication | Title: | Crystal structure of KRas G12D (GDP) in complex with compound 1 | Authors: | Amano, Y., Tateishi, Y. | Deposition date: | 2024-12-24 |
|
PDBID: | 9l6f | Status: | HPUB -- hold until publication | Title: | Crystal structure of KRas G12D (GDP) in complex with ASP3082 | Authors: | Amano, Y., Tateishi, Y. | Deposition date: | 2024-12-24 |
|
PDBID: | 9l6j | Status: | HPUB -- hold until publication | Title: | Structural studies on the conformation changes induced by ligand binding in an Adenine phosphoribosyltransferase (FnAPRT) from Fusobacterium nucleatum | Authors: | Kim, B., Hwang, J., Do, H., Lee, J.H. | Deposition date: | 2024-12-24 |
|
PDBID: | 9l6m | Status: | HPUB -- hold until publication | Title: | Crystal Structure of BRD2 BD1 domain in complex with small molecule inhibitor Isoxazole azepine compound. | Authors: | Jwala, N., Vijayshankar, N., Thomas, A., NarasimhaRao, K. | Deposition date: | 2024-12-24 | Sequence: | >Entity 1 MGSSHHHHHHSSGLVPRGSHMSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGA
|
|
PDBID: | 9l6n | Status: | HOLD -- hold until a certain date | Title: | PEDV 3CLpro mutant (C144A) in complex with nsp5/6 peptite substrate | Authors: | Zhang, Y., Zhang, D., Shi, Y.J., Peng, G.Q. | Deposition date: | 2024-12-24 | Release date: | 2025-12-24 |
|
PDBID: | 9l6p | Status: | HPUB -- hold until publication | Title: | Cryo-electron microscopic structure of a highly efficient ochratoxin detoxification enzyme LlADH | Authors: | Dai, L.H., Xu, Y.H., Hu, Y.M., Niu, D., He, B.Y., Huang, J.P., Xie, Z.Z., Li, H., Guo, R.-T., Chen, C.-C. | Deposition date: | 2024-12-24 |
|
PDBID: | 9mo3 | Status: | HPUB -- hold until publication | Title: | LINE-1 Reverse Transcriptase bound to an incorporated inhibitor-terminated DNA primer RNA template duplex and dTTP as the incoming base | Authors: | Nichols, C., Viacava Follis, A. | Deposition date: | 2024-12-24 |
|
PDBID: | 9mo1 | Status: | HPUB -- hold until publication | Title: | LINE-1 Reverse Transcriptase bound to a DNA primer RNA template duplex and triphosphate nucleoside inhibitor as the incoming base | Authors: | Nichols, C., Viacava Follis, A. | Deposition date: | 2024-12-24 |
|
PDBID: | 9mo2 | Status: | HPUB -- hold until publication | Deposition date: | 2024-12-24 |
|
PDBID: | 9huh | Status: | HPUB -- hold until publication | Title: | CryoEM structure of human peptidylarginine deiminase type 4 (PAD4) in 10 mM calcium | Authors: | Bereta, G.P., Bielecka, E., Biela, A.P., Wilk, P., Wator-Wilk, E., Grudnik, P., Kantyka, T. | Deposition date: | 2024-12-23 |
|
PDBID: | 9hus | Status: | HOLD -- hold until a certain date | Title: | Structure of WT E.coli ribosome with complexed filament nascent chain at length 31, with P-site tRNAs | Authors: | Mitropoulou, A., Wlodarski, T., Plessa, E., Cabrita, L.D., Christodoulou, J. | Deposition date: | 2024-12-23 | Release date: | 2025-12-23 |
|
PDBID: | 9hun | Status: | HPUB -- hold until publication | Title: | Crystal structure of feruloyl esterase from Fusarium oxysporum G122S variant in complex with benzoic acid | Authors: | Karampa, P., Dimarogona, M., Topakas, E., Makryniotis, K., Nikolaivits, E. | Deposition date: | 2024-12-23 |
|
PDBID: | 9hux | Status: | HPUB -- hold until publication | Title: | CryoEM map of the large glutamate dehydrogenase composed of 180 kDa subunits from Mycobacterium smegmatis obtained in the presence of NAD+ and L-glutamate. Open Tetramer. | Authors: | Lazaro, M., Chamorro, N., Lopez-Alonso, J.P., Charro, D., Rasia, R.M., Jimenez-Oses, G., Valle, M., Lisa, M.N. | Deposition date: | 2024-12-23 |
|
PDBID: | 9huq | Status: | HPUB -- hold until publication | Title: | Structure of WT E.coli ribosome with complexed filament nascent chain at length 47, with P-site tRNA | Authors: | Mitropoulou, A., Wlodarski, T., Plessa, E., Cabrita, L.D., Christodoulou, J. | Deposition date: | 2024-12-23 |
|
PDBID: | 9huy | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | CryoEM map of the large glutamate dehydrogenase composed of 180 kDa subunits from Mycobacterium smegmatis obtained in the presence of NAD+ and L-glutamate. Closed1 tetramer. | Authors: | Lazaro, M., Chamorro, N., Lopez-Alonso, J.P., Charro, D., Rasia, R.M., Jimenez-Oses, G., Valle, M., Lisa, M.N. | Deposition date: | 2024-12-23 |
|
PDBID: | 9huz | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | CryoEM map of the large glutamate dehydrogenase composed of 180 kDa subunits from Mycobacterium smegmatis obtained in the presence of NAD+ and L-glutamate. Closed2 tetramer | Authors: | Lazaro, M., Chamorro, N., Lopez-Alonso, J.P., Charro, D., Rasia, R.M., Jimenez-Oses, G., Valle, M., Lisa, M.N. | Deposition date: | 2024-12-23 |
|
PDBID: | 9huk | Status: | HPUB -- hold until publication | Title: | Crystal structure of human GSK3b in complex with ARN24161 | Authors: | Dalle Vedove, A., Di Martino, R.M.C., Storici, P., Girotto, S., Cavalli, A., Bottegoni, G. | Deposition date: | 2024-12-23 |
|
PDBID: | 9hv0 | Status: | HPUB -- hold until publication | Title: | CryoEM map of the large glutamate dehydrogenase composed of 180 kDa subunits from Mycobacterium smegmatis obtained in the presence of NAD+ and L-glutamate. Empty monomer. | Authors: | Lazaro, M., Chamorro, N., Lopez-Alonso, J.P., Charro, D., Rasia, R.M., Jimenez-Oses, G., Valle, M., Lisa, M.N. | Deposition date: | 2024-12-23 |
|
PDBID: | 9hul | Status: | HPUB -- hold until publication | Title: | Crystal structure of human GSK3b in complex with ARN25423 | Authors: | Dalle Vedove, A., Di Martino, R.M.C., Storici, P., Girotto, S., Cavalli, A., Bottegoni, G. | Deposition date: | 2024-12-23 |
|