| PDBID: | 9f4b | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-26 |
|
| PDBID: | 9f4a | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-26 |
|
| PDBID: | 9f46 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-26 |
|
| PDBID: | 9f3u | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-26 |
|
| PDBID: | 9f47 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-26 |
|
| PDBID: | 9f49 | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the bacteriophage K gp155 C-terminal domain, seleno-methionine modified version | | Authors: | Pichel, A., van Raaij, M.J. | | Deposition date: | 2024-04-26 | | Release date: | 2024-06-21 | | Sequence: | >Entity 1
KDF(MSE)LIGHRGATGYTDEHTIKGYQ(MSE)ALDKGADYIELDLQLTKDNKLLC(MSE)HDSTIDRTTTGTGKVGD(MSE)TLSYIQTNFTSLNGEPIPSLDDVLNHFGTKVKYYIETKRPFDAN(MSE)DRELLTQLKAKGLIGIGSERFQVIIQSFARESLINIHNQFSNIPLAYLTSTFSESE(MSE)DDCLSYGFYAIAPKYTTITKELVDLAHSKGLKVHAWTVNTKEE(MSE)QSLIQ(MSE)GVDGFFTNYLDEYKKI
|
|
| PDBID: | 8zbn | | Status: | HPUB -- hold until publication | | Title: | Mouse MYH6 R404Q left ventricle ATM complex | | Authors: | Li, D.N., Zhao, Q.Y., Liu, C. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 8zb3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NudC from Mycobacterium abscessus | | Authors: | Meng, L., Zhang, Y., Xu, J., Liu, J. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 8zb4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NudC from Mycobacterium abscessus in complex with NAD | | Authors: | Meng, L., Zhang, Y., Xu, J., Liu, J. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 8zb5 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NudC from Mycobacterium abscessus in complex with AMP | | Authors: | Meng, L., Zhang, Y., Xu, J., Liu, J. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 8zbf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-26 |
|
| PDBID: | 8zbb | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of outward state Anhydromuropeptide permease (AmpG) G50W/L269W | | Authors: | Yoo, Y., Chang, N., Kim, U., Kim, H., Cho, H. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 8zbi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-26 |
|
| PDBID: | 8zbd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Persulfide Dioxygenase from Beggiatoa leptomitoformis | | Authors: | Gabdulkhakov, A.G., Tishchenko, T.V., Rudenko, T.S. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 8zb2 | | Status: | HPUB -- hold until publication | | Title: | L-Methionine oxidase from Burkholderiales bacterium | | Authors: | Kawamura, Y., Chisuga, T., Nakano, S. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 8zbl | | Status: | HPUB -- hold until publication | | Title: | Glycosidated glycyrrhetinic acid derivative as a soluble epoxide hydrolase inhibitor | | Authors: | Wang, H., Feng, Y., Ge, Z.H. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 8zb7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human left ventricle ATM complex | | Authors: | Li, D.N., Zhao, Q.Y., Liu, C. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 8zbm | | Status: | HPUB -- hold until publication | | Title: | RAT skeletal muscle ATM complex | | Authors: | Li, D.N., Zhao, Q.Y., Liu, C. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 8zbc | | Status: | HPUB -- hold until publication | | Title: | An acyltransferase with selective perhydrolytic activity | | Authors: | Yin, Z., Jing, W. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 8zbk | | Status: | HPUB -- hold until publication | | Title: | Mouse left ventricle ATM complex | | Authors: | Li, D.N., Zhao, Q.Y., Liu, C. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 8zbh | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of TEAD3 YAP binding domain with compound 3 | | Authors: | Yoo, Y., Kim, H. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 8zbj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-26 |
|
| PDBID: | 8zau | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-25 |
|
| PDBID: | 8zay | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Fab | | Authors: | Adachi, Y., Nogi, T. | | Deposition date: | 2024-04-25 |
|
| PDBID: | 9f3r | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-25 |
|
