| PDBID: | 9ljd | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-15 |
|
| PDBID: | 9lje | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-15 |
|
| PDBID: | 9ljf | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-15 |
|
| PDBID: | 9mux | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9muw | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9mui | | Status: | HPUB -- hold until publication | | Title: | C. difficile RBD1 with Ca2+ | | Authors: | Hunter, D., Pozharski, E. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9mur | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Rubisco from Arabidopsis thaliana with the 2B small subunit isoform | | Authors: | Ceminsky, M., Askey, B., Gunn, L.H. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9mun | | Status: | HPUB -- hold until publication | | Title: | Structure of Human SLC33A1 in complex with oxidized glutathione | | Authors: | Gad, M., Hite, R.K. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9muq | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9muy | | Status: | HPUB -- hold until publication | | Title: | anti-IL6 designed Fab | | Authors: | Kiefer, J.R., Frey, N.C., Alberstein, R.G., Seeger, F., Watkins, A.M., Gligorijevic, V., Dou, Y., Tang, Y., Regev, A., Bonneau, R. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9muz | | Status: | HPUB -- hold until publication | | Title: | anti-IL6 designed Fab | | Authors: | Kiefer, J.R., Frey, N.C., Alberstein, R.G., Seeger, F., Watkins, A.M., Gligorijevic, V., Dou, Y., Tang, Y., Regev, A., Bonneau, R. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9i06 | | Status: | HPUB -- hold until publication | | Title: | Photosynthetic A8B8 glyceraldehyde-3-phosphate dehydrogenase (minor conformer) from Spinacia oleracea. | | Authors: | Marotta, R., Fermani, S., Sparla, F. | | Deposition date: | 2025-01-14 | | Sequence: | >Entity 1
KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKSATHLLKYDSILGTFKADVKIIDNETFSIDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGSDIPTYVVGVNEKDYGHDVANIISNASCTTNCLAPFVKVLDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKVGVTAEDVNNAFRKAAAGPLKGVLDVCDIPLVSVDFRCSDFSSTIDSSLTMVMGGDMVKVVAWYDNEWGYSQRVVDLADLVANKWPGLEGSVASGDPLEDFCKDNPADEECKLYE
>Entity 2
KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVKTAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWQA
|
|
| PDBID: | 9hzn | | Status: | HPUB -- hold until publication | | Title: | 250 A SynPspA H1-5 rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzo | | Status: | HPUB -- hold until publication | | Title: | 270 A C1 SynPspA H1-5 rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzp | | Status: | HPUB -- hold until publication | | Title: | 270 A C2 SynPspA H1-5 rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzq | | Status: | HPUB -- hold until publication | | Title: | 280 A SynPspA H1-5 rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzr | | Status: | HPUB -- hold until publication | | Title: | 290 A SynPspA H1-5 rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9i04 | | Status: | HPUB -- hold until publication | | Title: | Ku70/80, DNA bound to Polymerase Mu | | Authors: | Chaplin, A.K., Amin, H. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzs | | Status: | HPUB -- hold until publication | | Title: | 200 A SynPspA rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzt | | Status: | HPUB -- hold until publication | | Title: | 215 A SynPspA rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzu | | Status: | HPUB -- hold until publication | | Title: | 235 A SynPspA rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzv | | Status: | HPUB -- hold until publication | | Title: | 250 A SynPspA rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzw | | Status: | HPUB -- hold until publication | | Title: | 270 A SynPspA rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzx | | Status: | HPUB -- hold until publication | | Title: | 280 A SynPspA rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzy | | Status: | HPUB -- hold until publication | | Title: | 290 A SynPspA rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
