| PDBID: | 9f7k | | Status: | HPUB -- hold until publication | | Title: | Glutathione transferase epsilon 1 from Drosophila melanogaster in complex with glutathione | | Authors: | Didierjean, C., Schwartz, M., Neiers, F. | | Deposition date: | 2024-05-03 | | Sequence: | >Entity 1
MSSSGIVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEVPQEKLDAVHQGLKLLETFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDPATYPKVTAWLDRLNKLPYYKEINEAPAQSYVAFLRSKWTKLGDK
|
|
| PDBID: | 9f7j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8zdz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8zds | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8zdw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8zdt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8zdu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8zdx | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MjHKU4r-CoV-1 RBD bound to hDPP4 | | Authors: | Yang, M., Li, Z., Xu, Y., Zhang, S. | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8zdr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8zdv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8zdy | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-03 |
|
| PDBID: | 9bob | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 9boc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 9bnt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 9bny | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 9bo1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 9bo2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-03 |
|
| PDBID: | 9bo4 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-03 |
|
| PDBID: | 9bo5 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-03 |
|
| PDBID: | 9bo6 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-03 |
|
| PDBID: | 9bo7 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-03 |
|
| PDBID: | 9bns | | Status: | HPUB -- hold until publication | | Title: | Rhesus macaque ITS114.01 Fab in complex with SIV MPER peptide | | Authors: | Gorman, J., Lai, Y.-T., Kwong, P.D. | | Deposition date: | 2024-05-03 |
|
| PDBID: | 9bod | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 9boe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 9bo9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
