PDBID: | 9qt9 | Status: | HPUB -- hold until publication | Deposition date: | 2025-04-08 |
|
PDBID: | 9qtc | Status: | HPUB -- hold until publication | Title: | HINT1 complexed with GS-441524 | Authors: | Zimberger, C., Ferron, F. | Deposition date: | 2025-04-08 | Sequence: | >Entity 1 MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG
|
|
PDBID: | 9qta | Status: | HOLD -- hold until a certain date | Title: | Structure of vaccinia virus A26 (residues 1-397) in complex with Fab 10M2146 | Authors: | Guardado-Calvo, P., Battini, L. | Deposition date: | 2025-04-08 | Release date: | 2026-04-08 |
|
PDBID: | 9qtg | Status: | AUTH -- processed, waiting for author review and approval | Title: | Simkania negevensis CE-clan virulence factor SnCE1 in complex with hsSUMO1 | Authors: | Schmoeker, O., Girbardt, B., Palm, G.J., Hoppen, J., Schulze, S., Lammers, M. | Deposition date: | 2025-04-08 |
|
PDBID: | 9qt8 | Status: | HPUB -- hold until publication | Title: | Polyester Hydrolase Leipzig 7 (PHL7) variant R2M2-P155G | Authors: | Useini, A., Strater, N., Kuenze, G., Sonnendecker, C. | Deposition date: | 2025-04-08 |
|
PDBID: | 9qte | Status: | HPUB -- hold until publication | Title: | Simkania negevensis CE-clan virulence factor SnCE1 wildtype | Authors: | Schmoeker, O., Girbardt, B., Palm, G.J., Hoppen, J., Schulze, S., Lammers, M. | Deposition date: | 2025-04-08 |
|
PDBID: | 9qtb | Status: | HPUB -- hold until publication | Title: | Apo form of the L-protein from Rift Valley Fever Virus (LPapo) | Authors: | Kral, M., Das, A.R., Kotacka, T., Blahosova, A., Hodek, J., Konvalinka, J., Demo, G., Kozisek, M. | Deposition date: | 2025-04-08 |
|
PDBID: | 9qt7 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of affitin C10 fused to a coiled-coil domain in complex with a quinoline oligoamide foldamer | Authors: | Morozov, V., Wang, L., Kwon, S., Douat, C., Huc, I. | Deposition date: | 2025-04-08 |
|
PDBID: | 9udj | Status: | HPUB -- hold until publication | Title: | Crystal structure of PSD95 in complex with 4-dimethylaminophenol | Authors: | Li, H., Ouyang, Q., Zhu, J. | Deposition date: | 2025-04-07 |
|
PDBID: | 9udk | Status: | HPUB -- hold until publication | Deposition date: | 2025-04-07 |
|
PDBID: | 9ue2 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal Structure of the Fluoroacetate Dehalogenase RPA1163 - Lys181Ser/Trp185Gly/His280Ala with (S)-2-fluoro-3-(4-(trifluoromethyl)phenyl)propanoic acid | Authors: | Huang, H.S., Zhang, Z.M. | Deposition date: | 2025-04-07 |
|
PDBID: | 9udv | Status: | HPUB -- hold until publication | Title: | human G6P transporter SLC37A2 in an asymmetric state by adding G6P | Authors: | Sun, L., Liu, X., Lai, Q. | Deposition date: | 2025-04-07 |
|
PDBID: | 9udw | Status: | HPUB -- hold until publication | Title: | G6P bound SLC37A2 in a symmetric inward-facing state by adding G6P | Authors: | Sun, L., Liu, X., Lai, Q. | Deposition date: | 2025-04-07 |
|
PDBID: | 9udx | Status: | HPUB -- hold until publication | Title: | apo SLC37A2 in a symmetric outward-facing state by adding G6P | Authors: | Sun, L., Liu, X., Lai, Q. | Deposition date: | 2025-04-07 |
|
PDBID: | 9ue1 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-04-07 |
|
PDBID: | 9udn | Status: | HPUB -- hold until publication | Deposition date: | 2025-04-07 |
|
PDBID: | 9udo | Status: | HPUB -- hold until publication | Deposition date: | 2025-04-07 |
|
PDBID: | 9udp | Status: | HPUB -- hold until publication | Deposition date: | 2025-04-07 |
|
PDBID: | 9udr | Status: | HPUB -- hold until publication | Deposition date: | 2025-04-07 |
|
PDBID: | 9uds | Status: | HPUB -- hold until publication | Deposition date: | 2025-04-07 |
|
PDBID: | 9udt | Status: | HPUB -- hold until publication | Deposition date: | 2025-04-07 |
|
PDBID: | 9udl | Status: | HPUB -- hold until publication | Title: | Cocrystal structure of human cytosolic phenylalanyl-tRNA synthetase and an inhibitor | Authors: | Qiao, H., Hei, Z., Fang, P. | Deposition date: | 2025-04-07 |
|
PDBID: | 9udq | Status: | HPUB -- hold until publication | Title: | Crystal structure of MPXV A35R in complex with a neutralizing antibody MA42 | Authors: | Sun, D., Zhang, N., Guo, Y. | Deposition date: | 2025-04-07 |
|
PDBID: | 9ue0 | Status: | HPUB -- hold until publication | Title: | Crystal structure of MPXV A35R in complex with a neutralizing antibody MA49 | Authors: | Sun, D., Zhang, N., Guo, Y. | Deposition date: | 2025-04-07 |
|
PDBID: | 9udu | Status: | HPUB -- hold until publication | Deposition date: | 2025-04-07 |
|