| PDBID: | 9cyv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the Thermococcus sibiricus NfnABC complex | | Authors: | Xiao, X., Li, H. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the NAD(H)-bound Thermococcus sibiricus NfnABC complex | | Authors: | Xiao, X., Li, H. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cye | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyn | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyx | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9gcg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gcb | | Status: | HPUB -- hold until publication | | Title: | Structure of IsDUF4198 | | Authors: | Franco Cairo, J.P.L., Correa, T.L.R., Offen, W.A., Nairn, A., Walton, J., Davies, G.J., Walton, P.H. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gce | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gc2 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Arabidopsis thaliana PSI-LHCI- a603-NH mutant | | Authors: | Capaldi, S., Chaves-Sanjuan, A., Bonnet, D.M.V., Bassi, R. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gc4 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Highly optimized CNS penetrant inhibitors of EGFR Exon20 Insertion Mutations | | Authors: | Hargreaves, D. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gc5 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Highly optimized CNS penetrant inhibitors of EGFR Exon20 Insertion Mutations | | Authors: | Hargreaves, D. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gch | | Status: | HPUB -- hold until publication | | Title: | Human mitochondrial RNAseZ with tRNA-His-CCA | | Authors: | Valentin Gese, G., Hallberg, B.M. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gc1 | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH COMPOUND8 | | Authors: | Schaefer, M., Fuerstner, C. | | Deposition date: | 2024-08-01 | | Sequence: | >Entity 1
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQRNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDAKPPAVFTRISHYQPWINQILQAN
|
|
| PDBID: | 9gc6 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Highly optimized CNS penetrant inhibitors of EGFR Exon20 Insertion Mutations | | Authors: | Hargreaves, D. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gc8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Pseudomonas aeruginosa IspD in complex with C11H12N2O3 | | Authors: | Borel, F., D''Auria, L. | | Deposition date: | 2024-08-01 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMTTSDLPAFWTVIPAAGVGSRMRADRPKQYLDLAGRTVIERTLDCFLEHPMLRGLVVCLAEDDPYWPGLDCAASRHVQRAAGGAERAGSVLNGLLRLLELGAQADDWVLVHDAARPNLTRGDLDRLLEELAEDPVGGLLAVPARDTLKRSDRDGRVSETIDRSVVWLAYTPQMFRLGALHRALADALVAGVAITDEASAMEWAGYAPKLVEGRADNLKITTPEDLLRLQRSFPHLE
|
|
| PDBID: | 9gc9 | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH COMPOUND27 | | Authors: | Schaefer, M., Fuerstner, C. | | Deposition date: | 2024-08-01 | | Sequence: | >Entity 1
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQRNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDAKPPAVFTRISHYQPWINQILQAN
|
|
