| PDBID: | 9ctk | | Status: | HPUB -- hold until publication | | Title: | Modifying region of EcPKS2 - malonylCoA inhibited dataset | | Authors: | Schubert, H.L., Hill, C.P. | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9iwi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9ctl | | Status: | HPUB -- hold until publication | | Title: | Full length EcPKS2 - malonylCoA inhibited dataset | | Authors: | Schubert, H.L., Hill, C.P. | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9cu4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9ctu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9ctz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9cte | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-07-25 | | Release date: | 2025-07-25 |
|
| PDBID: | 9cu7 | | Status: | HPUB -- hold until publication | | Title: | Structure of 16.ND.92 Fab in complex with A/Solomon Islands/3/2006(H1N1) influenza virus Hemagglutinin | | Authors: | Ouyang, W.O., Pholcharee, T., Wu, N.C. | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9cu5 | | Status: | HPUB -- hold until publication | | Title: | LJF-085 Fab in complex with HIV Env JRFL NFL TD CC3+ trimer and 35O22 Fab | | Authors: | Ozorowski, G., Ward, A.B. | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9cto | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Full length EcPKS2 - acylated dataset with three ACP positions | | Authors: | Schubert, H.L., Hill, C.P. | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9cu0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9ctw | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SARS-CoV-2 M (long conformation) in the presence of C1P | | Authors: | Dolan, K.A., Brohawn, S.G. | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9cu1 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9cu2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9cty | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9cu6 | | Status: | HPUB -- hold until publication | | Title: | LJF-034 Fab in complex with HIV Env JRFL NFL TD CC3+ trimer and 35O22 Fab | | Authors: | Ozorowski, G., Ward, A.B. | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9g8t | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the persulfide dioxygenase (PDO - PA2915) from Pseudomonas aeruginosa | | Authors: | Troilo, F., Giordano, F., Giuffre, A., Giardina, G., Di Matteo, A. | | Deposition date: | 2024-07-24 | | Sequence: | >Entity 1
MLKPDITAFFDPATSTYSYVVRDPSSRACAIVDPVLDYDPAAGRTSHASAERLIAHVRQHDLQVEWLLETHVHADHLSAAIFLQRELGGCLAIGARITQVQAKFSGLFNLGEAFPVDGRQFEHLFEDGESFRIGALECRALHTPGHTPACMTYLVGDSAFVGDTLFMPDYGTARCDFPGGDARQLYRSIQRLFALPDATRLFMCHDYTAPGRDEHRCETSVGEQRRHNVHVREGVDEEAFVAMRQQRDATLGMPTLMLPAIQVNMRGGNLPPVEGNGVRYLKIPLDLFLEHHHHHH
|
|
| PDBID: | 9g98 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Joint neutron structure of alginate lyase PsAlg7C soaked with pentamannuronic acid | | Authors: | Wilkens, C., Meilleur, F., Morth, J.P. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g97 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g95 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g92 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of thioredoxin reductase from Cryptosporidium parvum in the ""in"" conformation | | Authors: | Gabriele, F., Palerma, M., Ardini, M., Bogard, J., Chen, X.M., Williams, D.L., Angelucci, F. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g90 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g8z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g8x | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g8y | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
