PDBID: | 8w3m | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Crystal Structure of Enterovirus 68 3C Protease with AG7404 at 1.97 Angstroms | Authors: | Azzolino, V.N., Shaqra, A.M., Schiffer, C.A. | Deposition date: | 2024-02-22 | Release date: | 2025-02-22 |
|
PDBID: | 8w3t | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Crystal Structure of Enterovirus 68 3C Protease with GC376 at 1.98 Angstroms | Authors: | Azzolino, V.N., Shaqra, A.M., Schiffer, C.A. | Deposition date: | 2024-02-22 | Release date: | 2025-02-22 |
|
PDBID: | 8w3e | Status: | HPUB -- hold until publication | Title: | Crystal structure of prefusion-stabilized RSV F protein UFCR1 | Authors: | Lee, Y.Z., Stanfield, R.L., Wilson, I.A., Zhu, J. | Deposition date: | 2024-02-22 |
|
PDBID: | 8w3f | Status: | HPUB -- hold until publication | Title: | Crystal structure of prefusion-stabilized RSV F protein UFCR1-P2-NQ | Authors: | Lee, Y.Z., Stanfield, R.L., Wilson, I.A., Zhu, J. | Deposition date: | 2024-02-22 |
|
PDBID: | 8ydp | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8ydr | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8yds | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8ydq | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8ydw | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8ydn | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-02-21 | Release date: | 2025-02-21 |
|
PDBID: | 8ydz | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8ydy | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8ydx | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8ye3 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human respiratory syncytial virus fusion protein variant | Authors: | Li, Q.M., Su, J.G., Zhang, J., Liang, Y., Shao, S., Li, X.Y., Zhao, Z.X. | Deposition date: | 2024-02-21 |
|
PDBID: | 8ye1 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8ye2 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8ydt | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8ydu | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8ydv | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8s42 | Status: | HPUB -- hold until publication | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 80 (1124898) | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4d | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4l | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4f | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 | Sequence: | >Entity 1 MSPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
PDBID: | 8s4j | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8s43 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-02-21 |
|