PDBID: | 9ezl | Status: | HPUB -- hold until publication | Title: | Crystal structure of trehalose synthase mutant N253H from Deinococcus radiodurans | Authors: | Ye, L.C., Chen, S.C. | Deposition date: | 2024-04-12 |
|
PDBID: | 8z1p | Status: | PROC -- to be processed | Deposition date: | 2024-04-11 |
|
PDBID: | 8z1k | Status: | AUTH -- processed, waiting for author review and approval | Title: | P ring on polyrod-P ring complex from Salmonella typhimurium HK26292 mutant | Authors: | Yamaguchi, T., Kato, T., Minamino, T., Namba, K. | Deposition date: | 2024-04-11 |
|
PDBID: | 8z1h | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of SARS main protease in complex with PF-00835231 | Authors: | Lin, C., Zhang, J., Li, J. | Deposition date: | 2024-04-11 | Release date: | 2025-04-11 |
|
PDBID: | 8z1q | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-11 |
|
PDBID: | 8z1j | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-11 |
|
PDBID: | 8z1g | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of human ELAC2-pre-tRNA | Authors: | Liu, Z.M., Xue, C.Y. | Deposition date: | 2024-04-11 |
|
PDBID: | 8z1e | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-11 |
|
PDBID: | 8z1f | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of human ELAC2-tRNA | Authors: | Liu, Z.M., Xue, C.Y. | Deposition date: | 2024-04-11 |
|
PDBID: | 8z1i | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of the isomerase Art22 | Authors: | Guo, L., Li, P.W., Li, D.F., Chen, Y.H. | Deposition date: | 2024-04-11 |
|
PDBID: | 8z1d | Status: | PROC -- to be processed | Deposition date: | 2024-04-11 |
|
PDBID: | 8z1b | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-11 |
|
PDBID: | 8z1c | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-11 |
|
PDBID: | 8z1r | Status: | AUTH -- processed, waiting for author review and approval | Title: | isocitrate lyase MoMcl1 | Authors: | Liu, X.H., Zhao, W.H. | Deposition date: | 2024-04-11 |
|
PDBID: | 8z1l | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-11 |
|
PDBID: | 8z1m | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-11 |
|
PDBID: | 8z1n | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-11 |
|
PDBID: | 8z1o | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-11 |
|
PDBID: | 8z1s | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-11 |
|
PDBID: | 9bd6 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-11 |
|
PDBID: | 9bdb | Status: | HPUB -- hold until publication | Title: | Bacillus anthracis BxpB homotrimer in complex with BclA NTD peptide | Authors: | Schormann, N., Green, T., Turnbough, C.L. | Deposition date: | 2024-04-11 | Sequence: | >Entity 1 MFSSDCEFTKIDCEAKPASTLPAFGFAFNASAPQFASLFTPLLLPSVSPNPNITVPVINDTVSVGDGIRILRAGIYQISYTLTISLDNSPVAPEAGRFFLSLGTPANIIPGSGTAVRSNVIGTGEVDVSSGVILINLNPGDLIRIVPVELIGTVDIRAAALTVAQIS
>Entity 2 AFDPNLVGPTLPPIPPFTL
|
|
PDBID: | 9bda | Status: | HPUB -- hold until publication | Title: | Bacillus anthracis BxpB homotrimer in complex with BclA NTD peptide | Authors: | Schormann, N., Green, T., Turnbough, C.L. | Deposition date: | 2024-04-11 | Sequence: | >Entity 1 MFSSDCEFTKIDCEAKPASTLPAFGFAFNASAPQFASLFTPLLLPSVSPNPNITVPVINDTVSVGDGIRILRAGIYQISYTLTISLDNSPVAPEAGRFFLSLGTPANIIPGSGTAVRSNVIGTGEVDVSSGVILINLNPGDLIRIVPVELIGTVDIRAAALTVAQIS
>Entity 2 AFDPNLVGPTLPPIPPFTL
|
|
PDBID: | 9bdd | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM Structure of Non-Cognate Substrate Bound in the Entry Site (ES) of Human Mitochondrial Transcription Elongation Complex | Authors: | Herbine, K.H., Nayak, A.R., Temiakov, D. | Deposition date: | 2024-04-11 |
|
PDBID: | 9bdc | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM Structure of the TEFM bound Human Mitochondrial Transcription Elongation Complex in a Closed Fingers Domain Conformation | Authors: | Herbine, K.H., Nayak, A.R., Temiakov, D. | Deposition date: | 2024-04-11 |
|
PDBID: | 9bd4 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-11 |
|