| PDBID: | 7i0k | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with ZINC000001722141 | | Authors: | Asthana, P., Fraser, J.S. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 7i0l | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with ZINC000016697555 | | Authors: | Asthana, P., Fraser, J.S. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 7i0m | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with Z1302549938 | | Authors: | Asthana, P., Fraser, J.S. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 7i0n | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with Z2440817672 | | Authors: | Asthana, P., Fraser, J.S. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 7i0o | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with Z747549372 | | Authors: | Asthana, P., Fraser, J.S. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 7i0p | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with Z287010572 | | Authors: | Asthana, P., Fraser, J.S. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 7i0q | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with PV-006358264279 | | Authors: | Asthana, P., Fraser, J.S. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 7i0r | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with Z1263798799 | | Authors: | Asthana, P., Fraser, J.S. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 7i0s | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with Z2046612904 | | Authors: | Asthana, P., Fraser, J.S. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 7i0t | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with Z4090027317 | | Authors: | Asthana, P., Fraser, J.S. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 7i0u | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with Z798857536 | | Authors: | Asthana, P., Fraser, J.S. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 7i0v | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with Z1441867474 | | Authors: | Asthana, P., Fraser, J.S. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 7i0w | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with Z5440841580 | | Authors: | Asthana, P., Fraser, J.S. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 7i0x | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with Z2301759489 | | Authors: | Asthana, P., Fraser, J.S. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 7i0y | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with Z790365490 | | Authors: | Asthana, P., Fraser, J.S. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 7i0z | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with Z1500734581 | | Authors: | Asthana, P., Fraser, J.S. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 7i10 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with Z295930154 | | Authors: | Asthana, P., Fraser, J.S. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 7i11 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with Z1152041263 | | Authors: | Asthana, P., Fraser, J.S. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 7i12 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with Z3562614682 | | Authors: | Asthana, P., Fraser, J.S. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 9i4k | | Status: | HPUB -- hold until publication | | Title: | Galectin-1 in Complex with Methyl 6-fluoro-N-acetyllactosaminide | | Authors: | Pachl, P. | | Deposition date: | 2025-01-25 | | Sequence: | >Entity 1
SMACGLVASNLNLKPGE(CME)LRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNSKDGGAWGTEQREAVFPFQPGSVAEV(CME)ITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAADGDFKIK(CME)VAFD
|
|
| PDBID: | 9i4l | | Status: | HPUB -- hold until publication | | Title: | Galectin-1 in Complex with Methyl 2''-fluoro-N-acetyllactosaminide | | Authors: | Pachl, P. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 9i4m | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Galectin-1 in Complex with Methyl 3''-fluoro-N-acetyllactosaminide | | Authors: | Pachl, P. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 9i4n | | Status: | HPUB -- hold until publication | | Title: | Galectin-3 in Complex with Methyl 6-fluoro-N-acetyllactosaminide | | Authors: | Pachl, P. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 9i4o | | Status: | HPUB -- hold until publication | | Title: | Galectin-3 in Complex with Methyl 2''-fluoro-N-acetyllactosaminide | | Authors: | Pachl, P. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 9i4p | | Status: | HPUB -- hold until publication | | Title: | Galectin-3 in Complex with Methyl 3''-fluoro-N-acetyllactosaminide | | Authors: | Pachl, P. | | Deposition date: | 2025-01-25 |
|
