PDBID: | 9cma | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-13 |
|
PDBID: | 9cm9 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure-derived insights from blood factors binding to surfaces of different adenoviruses | Authors: | Reddy, V.S., Ma, O.X. | Deposition date: | 2024-07-13 |
|
PDBID: | 9cm8 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-13 |
|
PDBID: | 9cmb | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-13 |
|
PDBID: | 0585 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3v | Status: | HPUB -- hold until publication | Title: | Structure of the human nuclear cap-binding-complex (CBC) | Authors: | Martin, K., Hoh, F., Trapani, S., Tazi, J., Bron, P. | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3h | Status: | AUTH -- processed, waiting for author review and approval | Title: | Circularly permuted lumazine synthase twisted tube with no gap between between double strands | Authors: | Koziej, L., Azuma, Y. | Deposition date: | 2024-07-12 | Release date: | 2025-07-12 |
|
PDBID: | 9g3i | Status: | HOLD -- hold until a certain date | Title: | Circularly permuted lumazine synthase twisted tube with 18 Angstrom gap between double strands | Authors: | Koziej, L., Azuma, Y. | Deposition date: | 2024-07-12 | Release date: | 2025-07-12 |
|
PDBID: | 9g3j | Status: | HOLD -- hold until a certain date | Title: | Circularly permuted lumazine synthase twisted tube with 28 Angstrom gap between double strands | Authors: | Koziej, L., Azuma, Y. | Deposition date: | 2024-07-12 | Release date: | 2025-07-12 |
|
PDBID: | 9g3k | Status: | HPUB -- hold until publication | Title: | LecB from PA01 in complex with synthetic beta - fucosylamide | Authors: | Antonini, G., Varrot, A. | Deposition date: | 2024-07-12 | Sequence: | >Entity 1 ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
|
|
PDBID: | 9g40 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3z | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of the Open gamma-Tubulin Ring Complex from Pig Brain | Authors: | Munoz-Hernandez, H., Wieczorek, M. | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3y | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of the Native CMG-decorated gamma-Tubulin Ring Complex from Pig Brain | Authors: | Munoz-Hernandez, H., Wieczorek, M. | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3x | Status: | HPUB -- hold until publication | Title: | Structure of the Partially-assembled gamma-Tubulin Ring Complex from Pig Brain | Authors: | Munoz-Hernandez, H., Wieczorek, M. | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3l | Status: | AUTH -- processed, waiting for author review and approval | Title: | LecB from PA01 in complex with synthetic beta - fucosylamide | Authors: | Antonini, G., Varrot, A. | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3q | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3d | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3e | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3f | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3g | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3r | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3s | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3w | Status: | HPUB -- hold until publication | Title: | Human Gamma-D crystallin R36S mutant with TNB-Cystein Protein modification | Authors: | Hill, J.A., Pulnova, Y., Yorke, B.A. | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3m | Status: | HOLD -- hold until a certain date | Title: | Circularly permuted lumazine synthase triple-stranded straight tube | Authors: | Koziej, L., Azuma, Y. | Deposition date: | 2024-07-12 | Release date: | 2025-07-12 |
|
PDBID: | 9g3n | Status: | HOLD -- hold until a certain date | Title: | Circularly permuted lumazine synthase 36-pentamer spherical cage | Authors: | Koziej, L., Azuma, Y. | Deposition date: | 2024-07-12 | Release date: | 2025-07-12 |
|