| PDBID: | 9eku | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ekv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ekw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ekx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9eky | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ekz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9el0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9el1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ekr | | Status: | HPUB -- hold until publication | | Title: | Human Hsp27 alpha-crystallin domain (84-171) R136W in complex with a peptide mimic of its C-terminus | | Authors: | Benesch, J.L.P., Allison, T.M., Gastall, H., Laganowsky, A. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9el5 | | Status: | HPUB -- hold until publication | | Title: | FANCM translocase domain bound to DNA | | Authors: | Bythell-Douglas, R., Murphy, V., Deans, A.J., Abbouche, L., Wolf, J., Rigoreau, L., Chapman, K. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ekp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of WDR55 in complex with XS381774 | | Authors: | Chen, U.H., Li, F., Zeng, H., Ahmad, H., Wang, X., Sun, J., Dong, A., Seitova, A., Arrowsmith, C.H., Edwards, A.M., Peng, H., Halabelian, L., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-12-03 | | Sequence: | >Entity 1
SMEAPTRIRDTPEDIVLEAPASGLAFHPARDLLAAGDVDGDVFVFSYSCQEGETKELWSSGHHLKACRAVAFSEDGQKLITVSKDKAIHVLDVEQGQLERRVSKAHGAPINSLLLVDENVLATGDDTGGIRLWDQRKEGPLMDMRQHEEYIADMALDPAKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLTSVTLMKWGKKVACGSSEGTIYLFNWNGFGATSDRFALRAESIDCMVPVTESLLCTGSTDGVIRAVNILPNRVVGSVGQHTGEPVEELALSHCGRFLASSGHDQRLKFWDMAQLRAVVVDD
|
|
| PDBID: | 9el4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of SARS-CoV-2 Mpro mutant E166A with Pfizer Intravenous Inhibitor PF-00835231 | | Authors: | Zvornicanin, S.N., Shaqra, A.M., Schiffer, C.A. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9el2 | | Status: | HPUB -- hold until publication | | Title: | Human Hsp27 alpha-crystallin domain (84-171) T151I in complex with a peptide mimic of its C-terminus | | Authors: | Benesch, J.L.P., Allison, T.M., Gastall, H., Laganowsky, A. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9el3 | | Status: | HPUB -- hold until publication | | Title: | Human Hsp27 alpha-crystallin domain (84-171) T164A in complex with a peptide mimic of its C-terminus | | Authors: | Benesch, J.L.P., Allison, T.M., Gastall, H., Laganowsky, A. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ku3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ku1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9kty | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the TIA-1 prion-like domain amyloid fibril, WT | | Authors: | Inaoka, D., Miyata, T., Makino, F., Ohtani, Y., Ekari, M., Kobayashi, R., Imamura, K., Sakamoto, E., Kodama, S.T., Yoshida, N., Kato, T., Namba, K., Tochio, H., Sekiyama, N. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ktz | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the TIA-1 prion-like domain amyloid fibril, G355R | | Authors: | Inaoka, D., Miyata, T., Makino, F., Ohtani, Y., Ekari, M., Kobayashi, R., Imamura, K., Sakamoto, E., Kodama, S.T., Yoshida, N., Kato, T., Namba, K., Tochio, H., Sekiyama, N. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ku5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ku7 | | Status: | HPUB -- hold until publication | | Title: | complex structure of methyltransferases SMYD2 and inhibitor (17) | | Authors: | Sun, Y.L., Lu, J., Zhao, K.H., Lu, W.C. | | Deposition date: | 2024-12-03 | | Sequence: | >Entity 1
GRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
|
|
| PDBID: | 9ku0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ku9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9kug | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ku2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ktu | | Status: | HPUB -- hold until publication | | Title: | Structure of TauT in complex with beta-alanine | | Authors: | Yin, Y.X., Lu, Y.S., Ding, D. | | Deposition date: | 2024-12-03 |
|
