Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
Status search: 14322 results
PDBID:9ls6
Status:HPUB -- hold until publication
Deposition date:2025-02-03
PDBID:9ls5
Status:HPUB -- hold until publication
Deposition date:2025-02-03
PDBID:9i7w
Status:HPUB -- hold until publication
Title:Extended and wrapped protein P7 dimers of dimers, the P1 layer and the RNA-dependent RNA polymerase P2 in transcribing particles of bacteriophage phi6
Authors:Kumpula, E.-P., Ilca, S.L., Huiskonen, J.T.
Deposition date:2025-02-03
PDBID:9i80
Status:HPUB -- hold until publication
Title:LecA in complex with a tolcapone derivative glycomimetic
Authors:Varrot, A.
Deposition date:2025-02-03
Sequence:

>Entity 1


AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
PDBID:9i7z
Status:HPUB -- hold until publication
Title:LecA in complex with 2-fluoro non-carbohydrate glycomimetic
Authors:Varrot, A.
Deposition date:2025-02-03
Sequence:

>Entity 1


AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
PDBID:9i7x
Status:HPUB -- hold until publication
Deposition date:2025-02-03
PDBID:9i7y
Status:HPUB -- hold until publication
Title:Crystal Structure of KRasG13C in Complex with Nucleotide-based Covalent Inhibitor 7b
Authors:Niggenaber, J., Mueller, M.P., Rauh, D.
Deposition date:2025-02-03
PDBID:7i13
Status:AUTH -- processed, waiting for author review and approval
Title:PanDDA analysis group deposition -- Main Protease (SARS-CoV-2) in complex with fragment B05 from the F2X-Entry Screen in orthorhombic space group
Authors:Barthel, T., Benz, L.S., Wollenhaupt, J., Weiss, M.S.
Deposition date:2025-02-03
PDBID:7i14
Status:AUTH -- processed, waiting for author review and approval
Title:PanDDA analysis group deposition -- Main Protease (SARS-CoV-2) in complex with fragment B08 from the F2X-Entry Screen in orthorhombic space group
Authors:Barthel, T., Benz, L.S., Wollenhaupt, J., Weiss, M.S.
Deposition date:2025-02-03
PDBID:7i15
Status:AUTH -- processed, waiting for author review and approval
Title:PanDDA analysis group deposition -- Main Protease (SARS-CoV-2) in complex with fragment C02 from the F2X-Entry Screen in orthorhombic space group
Authors:Barthel, T., Benz, L.S., Wollenhaupt, J., Weiss, M.S.
Deposition date:2025-02-03
PDBID:7i16
Status:AUTH -- processed, waiting for author review and approval
Title:PanDDA analysis group deposition -- Main Protease (SARS-CoV-2) in complex with fragment C07 from the F2X-Entry Screen in orthorhombic space group
Authors:Barthel, T., Benz, L.S., Wollenhaupt, J., Weiss, M.S.
Deposition date:2025-02-03
PDBID:7i17
Status:AUTH -- processed, waiting for author review and approval
Title:PanDDA analysis group deposition -- Main Protease (SARS-CoV-2) in complex with fragment C10 from the F2X-Entry Screen in orthorhombic space group
Authors:Barthel, T., Benz, L.S., Wollenhaupt, J., Weiss, M.S.
Deposition date:2025-02-03
PDBID:7i18
Status:AUTH -- processed, waiting for author review and approval
Title:PanDDA analysis group deposition -- Main Protease (SARS-CoV-2) in complex with fragment D04 from the F2X-Entry Screen in orthorhombic space group
Authors:Barthel, T., Benz, L.S., Wollenhaupt, J., Weiss, M.S.
Deposition date:2025-02-03
PDBID:7i19
Status:AUTH -- processed, waiting for author review and approval
Title:PanDDA analysis group deposition -- Main Protease (SARS-CoV-2) in complex with fragment D08 from the F2X-Entry Screen in orthorhombic space group
Authors:Barthel, T., Benz, L.S., Wollenhaupt, J., Weiss, M.S.
Deposition date:2025-02-03
PDBID:7i1a
Status:AUTH -- processed, waiting for author review and approval
Title:PanDDA analysis group deposition -- Main Protease (SARS-CoV-2) in complex with fragment D11 from the F2X-Entry Screen in orthorhombic space group
Authors:Barthel, T., Benz, L.S., Wollenhaupt, J., Weiss, M.S.
Deposition date:2025-02-03
PDBID:7i1c
Status:AUTH -- processed, waiting for author review and approval
Title:PanDDA analysis group deposition -- Main Protease (SARS-CoV-2) in complex with fragment E11 from the F2X-Entry Screen in orthorhombic space group
Authors:Barthel, T., Benz, L.S., Wollenhaupt, J., Weiss, M.S.
Deposition date:2025-02-03
PDBID:7i1d
Status:AUTH -- processed, waiting for author review and approval
Title:PanDDA analysis group deposition -- Main Protease (SARS-CoV-2) in complex with fragment F04 from the F2X-Entry Screen in orthorhombic space group
Authors:Barthel, T., Benz, L.S., Wollenhaupt, J., Weiss, M.S.
Deposition date:2025-02-03
PDBID:7i1e
Status:AUTH -- processed, waiting for author review and approval
Title:PanDDA analysis group deposition -- Main Protease (SARS-CoV-2) in complex with fragment G03 from the F2X-Entry Screen in orthorhombic space group
Authors:Barthel, T., Benz, L.S., Wollenhaupt, J., Weiss, M.S.
Deposition date:2025-02-03
PDBID:7i1f
Status:AUTH -- processed, waiting for author review and approval
Title:PanDDA analysis group deposition -- Main Protease (SARS-CoV-2) in complex with fragment G04 from the F2X-Entry Screen in orthorhombic space group
Authors:Barthel, T., Benz, L.S., Wollenhaupt, J., Weiss, M.S.
Deposition date:2025-02-03
PDBID:7i1g
Status:AUTH -- processed, waiting for author review and approval
Title:PanDDA analysis group deposition -- Main Protease (SARS-CoV-2) in complex with fragment G09 from the F2X-Entry Screen in orthorhombic space group
Authors:Barthel, T., Benz, L.S., Wollenhaupt, J., Weiss, M.S.
Deposition date:2025-02-03
PDBID:7i1h
Status:AUTH -- processed, waiting for author review and approval
Title:PanDDA analysis group deposition -- Main Protease (SARS-CoV-2) in complex with fragment G10 from the F2X-Entry Screen in orthorhombic space group
Authors:Barthel, T., Benz, L.S., Wollenhaupt, J., Weiss, M.S.
Deposition date:2025-02-03
PDBID:7i1i
Status:AUTH -- processed, waiting for author review and approval
Title:PanDDA analysis group deposition -- Main Protease (SARS-CoV-2) in complex with fragment H03 from the F2X-Entry Screen in orthorhombic space group
Authors:Barthel, T., Benz, L.S., Wollenhaupt, J., Weiss, M.S.
Deposition date:2025-02-03
PDBID:7i1j
Status:AUTH -- processed, waiting for author review and approval
Title:PanDDA analysis group deposition -- Main Protease (SARS-CoV-2) in complex with fragment H11 from the F2X-Entry Screen in orthorhombic space group
Authors:Barthel, T., Benz, L.S., Wollenhaupt, J., Weiss, M.S.
Deposition date:2025-02-03
PDBID:9n4k
Status:HPUB -- hold until publication
Deposition date:2025-02-03
PDBID:9n51
Status:AUTH -- processed, waiting for author review and approval
Deposition date:2025-02-03

234136

PDB entries from 2025-04-02

PDB statisticsPDBj update infoContact PDBjnumon