PDBID: | 9ls6 | Status: | HPUB -- hold until publication | Deposition date: | 2025-02-03 |
|
PDBID: | 9ls5 | Status: | HPUB -- hold until publication | Deposition date: | 2025-02-03 |
|
PDBID: | 9i7w | Status: | HPUB -- hold until publication | Title: | Extended and wrapped protein P7 dimers of dimers, the P1 layer and the RNA-dependent RNA polymerase P2 in transcribing particles of bacteriophage phi6 | Authors: | Kumpula, E.-P., Ilca, S.L., Huiskonen, J.T. | Deposition date: | 2025-02-03 |
|
PDBID: | 9i80 | Status: | HPUB -- hold until publication | Title: | LecA in complex with a tolcapone derivative glycomimetic | Authors: | Varrot, A. | Deposition date: | 2025-02-03 | Sequence: | >Entity 1 AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
|
|
PDBID: | 9i7z | Status: | HPUB -- hold until publication | Title: | LecA in complex with 2-fluoro non-carbohydrate glycomimetic | Authors: | Varrot, A. | Deposition date: | 2025-02-03 | Sequence: | >Entity 1 AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
|
|
PDBID: | 9i7x | Status: | HPUB -- hold until publication | Deposition date: | 2025-02-03 |
|
PDBID: | 9i7y | Status: | HPUB -- hold until publication | Title: | Crystal Structure of KRasG13C in Complex with Nucleotide-based Covalent Inhibitor 7b | Authors: | Niggenaber, J., Mueller, M.P., Rauh, D. | Deposition date: | 2025-02-03 |
|
PDBID: | 7i13 | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Main Protease (SARS-CoV-2) in complex with fragment B05 from the F2X-Entry Screen in orthorhombic space group | Authors: | Barthel, T., Benz, L.S., Wollenhaupt, J., Weiss, M.S. | Deposition date: | 2025-02-03 |
|
PDBID: | 7i14 | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Main Protease (SARS-CoV-2) in complex with fragment B08 from the F2X-Entry Screen in orthorhombic space group | Authors: | Barthel, T., Benz, L.S., Wollenhaupt, J., Weiss, M.S. | Deposition date: | 2025-02-03 |
|
PDBID: | 7i15 | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Main Protease (SARS-CoV-2) in complex with fragment C02 from the F2X-Entry Screen in orthorhombic space group | Authors: | Barthel, T., Benz, L.S., Wollenhaupt, J., Weiss, M.S. | Deposition date: | 2025-02-03 |
|
PDBID: | 7i16 | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Main Protease (SARS-CoV-2) in complex with fragment C07 from the F2X-Entry Screen in orthorhombic space group | Authors: | Barthel, T., Benz, L.S., Wollenhaupt, J., Weiss, M.S. | Deposition date: | 2025-02-03 |
|
PDBID: | 7i17 | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Main Protease (SARS-CoV-2) in complex with fragment C10 from the F2X-Entry Screen in orthorhombic space group | Authors: | Barthel, T., Benz, L.S., Wollenhaupt, J., Weiss, M.S. | Deposition date: | 2025-02-03 |
|
PDBID: | 7i18 | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Main Protease (SARS-CoV-2) in complex with fragment D04 from the F2X-Entry Screen in orthorhombic space group | Authors: | Barthel, T., Benz, L.S., Wollenhaupt, J., Weiss, M.S. | Deposition date: | 2025-02-03 |
|
PDBID: | 7i19 | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Main Protease (SARS-CoV-2) in complex with fragment D08 from the F2X-Entry Screen in orthorhombic space group | Authors: | Barthel, T., Benz, L.S., Wollenhaupt, J., Weiss, M.S. | Deposition date: | 2025-02-03 |
|
PDBID: | 7i1a | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Main Protease (SARS-CoV-2) in complex with fragment D11 from the F2X-Entry Screen in orthorhombic space group | Authors: | Barthel, T., Benz, L.S., Wollenhaupt, J., Weiss, M.S. | Deposition date: | 2025-02-03 |
|
PDBID: | 7i1c | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Main Protease (SARS-CoV-2) in complex with fragment E11 from the F2X-Entry Screen in orthorhombic space group | Authors: | Barthel, T., Benz, L.S., Wollenhaupt, J., Weiss, M.S. | Deposition date: | 2025-02-03 |
|
PDBID: | 7i1d | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Main Protease (SARS-CoV-2) in complex with fragment F04 from the F2X-Entry Screen in orthorhombic space group | Authors: | Barthel, T., Benz, L.S., Wollenhaupt, J., Weiss, M.S. | Deposition date: | 2025-02-03 |
|
PDBID: | 7i1e | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Main Protease (SARS-CoV-2) in complex with fragment G03 from the F2X-Entry Screen in orthorhombic space group | Authors: | Barthel, T., Benz, L.S., Wollenhaupt, J., Weiss, M.S. | Deposition date: | 2025-02-03 |
|
PDBID: | 7i1f | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Main Protease (SARS-CoV-2) in complex with fragment G04 from the F2X-Entry Screen in orthorhombic space group | Authors: | Barthel, T., Benz, L.S., Wollenhaupt, J., Weiss, M.S. | Deposition date: | 2025-02-03 |
|
PDBID: | 7i1g | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Main Protease (SARS-CoV-2) in complex with fragment G09 from the F2X-Entry Screen in orthorhombic space group | Authors: | Barthel, T., Benz, L.S., Wollenhaupt, J., Weiss, M.S. | Deposition date: | 2025-02-03 |
|
PDBID: | 7i1h | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Main Protease (SARS-CoV-2) in complex with fragment G10 from the F2X-Entry Screen in orthorhombic space group | Authors: | Barthel, T., Benz, L.S., Wollenhaupt, J., Weiss, M.S. | Deposition date: | 2025-02-03 |
|
PDBID: | 7i1i | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Main Protease (SARS-CoV-2) in complex with fragment H03 from the F2X-Entry Screen in orthorhombic space group | Authors: | Barthel, T., Benz, L.S., Wollenhaupt, J., Weiss, M.S. | Deposition date: | 2025-02-03 |
|
PDBID: | 7i1j | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Main Protease (SARS-CoV-2) in complex with fragment H11 from the F2X-Entry Screen in orthorhombic space group | Authors: | Barthel, T., Benz, L.S., Wollenhaupt, J., Weiss, M.S. | Deposition date: | 2025-02-03 |
|
PDBID: | 9n4k | Status: | HPUB -- hold until publication | Deposition date: | 2025-02-03 |
|
PDBID: | 9n51 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-02-03 |
|