| PDBID: | 8zkf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8zkg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8zkj | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of apo-LDHC | | Authors: | Wu, C.Y., Wang, H.L. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8zki | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8zkn | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8zkl | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The structure of vibrio cholerae phage VP1 capsid protein | | Authors: | Liu, H.R., Pang, H. | | Deposition date: | 2024-05-16 | | Release date: | 2025-05-16 |
|
| PDBID: | 8zkm | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | portal-tail of Vibrio cholerae typing phage release VP1 | | Authors: | Liu, H.R., Pang, H. | | Deposition date: | 2024-05-16 | | Release date: | 2025-05-16 |
|
| PDBID: | 8zkk | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Portal-tail of Vibrio cholerae typing phage mature VP1 | | Authors: | Liu, H.R., Pang, H. | | Deposition date: | 2024-05-16 | | Release date: | 2025-05-16 |
|
| PDBID: | 9bu5 | | Status: | HPUB -- hold until publication | | Title: | CC ProXp-ala apo solution structure | | Authors: | Duran, A.D., Foster, M.P. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9bu7 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM Structure of AAV2 Rep68 bound to integration site AAVS1: Insights into the mechanism of DNA melting. | | Authors: | Escalante, C.R. | | Deposition date: | 2024-05-16 | | Sequence: | >Entity 1
GPPGFYEIVIKVPSDLDGHLPGISDSFVNWVAEKEWELPPDSDMDLNLIEQAPLTVAEKLQRDFLTEWRRVSKAPEALFFVQFEKGESYFHMHVLVETTGVKSMVLGRFLSQIREKLIQRIYRGIEPTLPNWFAVTKTRNGAGGGNKVVDESYIPNYLLPKTQPELQWAWTNMEQYLSACLNLTERKRLVAQHLTHVSQTQEQNKENQNPNSDAPVIRSKTSARYMELVGWLVDKGITSEKQWIQEDQASYISFNAASNSRSQIKAALDNAGKIMSLTKTAPDYLVGQQPVEDISSNRIYKILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFPFNDCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRVDQKCKSSAQIDPTPVIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFYVKKGG
>Entity 2
(DG)(DT)(DT)(DG)(DG)(DG)(DG)(DC)(DT)(DC)(DG)(DG)(DC)(DG)(DC)(DT)(DC)(DG)(DC)(DT)(DC)
>Entity 3
(DG)(DA)(DG)(DC)(DG)(DA)(DG)(DC)(DG)(DC)(DC)(DG)(DA)(DG)(DC)(DC)(DC)(DC)(DA)(DA)(DC)
|
|
| PDBID: | 9bu4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of an MKP5 mutant, Y435W, in complex with an allosteric inhibitor | | Authors: | Manjula, R., Bennett, A.M., Lolis, E. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9bu9 | | Status: | HPUB -- hold until publication | | Title: | Mixed-valent (2/3) dimanganese SfbO | | Authors: | Liu, C., Rittle, J. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9bua | | Status: | HPUB -- hold until publication | | Title: | SfbO reconstituted with Mn(II) anaerobically | | Authors: | Liu, C., Rittle, J. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9bub | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9bu2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9buc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9bue | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human calcitonin Receptor in complex with Gs and cagrilintide in the CT-like conformation (repeat) | | Authors: | Cao, J., Belousoff, M.J., Johnson, R.M., Sexton, P.M., Wootten, D.L. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9bu8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9bu6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9bu3 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9bud | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fc2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9fcg | | Status: | HPUB -- hold until publication | | Title: | Medicago truncatula 5''-ProFAR isomerase (HISN3) D57N mutant in complex with PrFAR | | Authors: | Witek, W., Imiolczyk, B., Ruszkowski, M. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9fca | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9fcb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-15 |
|
