| PDBID: | 9odj | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9odk | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9odl | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9odm | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9odn | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9odo | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9odp | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9odu | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9odt | | Status: | HPUB -- hold until publication | | Title: | The structure of a Bacterial Cyanide Dihydratase from Bacillus safensis PER-URP-08 | | Authors: | Justo Arevalo, S., Valle-Riestra F, V., Balan, A., Chuck, C.S. | | Deposition date: | 2025-04-27 | | Sequence: | >Entity 1
MTSIYPKFRAAAVQAAPVYLNLEATVEKSCELIDEAASNGAKLVAFPEAFLPGYPWFAFIGHPEYTRKFYHELYKNAVEIPSLAIQKISEAAKRNETYVCISCSEKDGGSLYLAQLWFNPNGDLIGKHRKMRASVAERLIWGDGSGSMMPVFQTDIGNLGGLMCWEHQVPLDLMAMNAQNEQVHVASWPGYFDDEISSRYYAIATQTFVLMTSSIYTEEMKEMICLTQEQRDYFETFKSGHTCIYGPDGEPISDMVPAETEGIAYAEIDVERVIDYKYYIDPAGHYSNQSLSMNFNQQPTPVVKQLYHQKNEVFTYEDIQYQHGILEEKV
|
|
| PDBID: | 9odq | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9ode | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9r1i | | Status: | HPUB -- hold until publication | | Title: | Keap1 - inhibitor complex - 3 | | Authors: | Talapatra, S.K., Kozielski, F., Wells, G. | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9r1j | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9r1k | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9r1l | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9r1m | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9r1n | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9r1o | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9uor | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-26 |
|
| PDBID: | 9uos | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-26 |
|
| PDBID: | 9uol | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-26 |
|
| PDBID: | 9uou | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-26 |
|
| PDBID: | 9uot | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the oxytocin receptor bound to nanobody Nb2G5 | | Authors: | Gao, K., Nie, J., Zhang, X., Liu, X. | | Deposition date: | 2025-04-26 |
|
| PDBID: | 9uoo | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-04-26 | | Release date: | 2026-04-26 |
|
| PDBID: | 9uom | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-26 |
|
