| PDBID: | 9kkw | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9kl0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9klq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of ChCas12b-sgRNA-extended non-target DNA ternary complex (Complex-D) | | Authors: | Li, Y., Li, J., Pei, X., Gan, J., Lin, J. | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9kks | | Status: | HOLD -- hold until a certain date | | Title: | Solution NMR structure of Pseudoazurin | | Authors: | Yamaguchi, T., Obara, Y., Fujikawa, K., Yamasaki, K., Kohzuma, T. | | Deposition date: | 2024-11-14 | | Release date: | 2025-11-14 | | Sequence: | >Entity 1
ADFEVHMLNKGKDGAMVFEPASLKVAPGDTVTFIPTDKGHNVETIKGMIPDGAEAFKSKINENYKVTFTAPGVYGVKCTPHYGMGMVGVVQVGDAPANLEAVKGAKNPKKAQERLDAALAALGN
|
|
| PDBID: | 9kl3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9kl2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Pleurocybella porrigens lectin (PPL) in complex with GalNAc | | Authors: | Adachi, D., Ishimoto, N., Kawabata, H., Mizutani, K., Park, S.-Y., Tame, J.R.H., Kamata, K. | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9kkn | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9kko | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9klb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9he7 | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Psathyrella aberdarensis (PabUPO-II) in complex with myristic acid | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-11-13 |
|
| PDBID: | 9he9 | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Psathyrella aberdarensis (PabUPO-II) in complex with lauric acid | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-11-13 |
|
| PDBID: | 9heb | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Psathyrella aberdarensis (PabUPO-II) in complex with tetradecane | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-11-13 |
|
| PDBID: | 9hea | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Psathyrella aberdarensis (PabUPO-II) in complex with dodecane | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-11-13 |
|
| PDBID: | 9hec | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Psathyrella aberdarensis (PabUPO-II) in complex with alpha-ionone | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-11-13 |
|
| PDBID: | 9hed | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Psathyrella aberdarensis (PabUPO-II) in complex with alpha-damascone | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-11-13 |
|
| PDBID: | 9he0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-13 |
|
| PDBID: | 9hdu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-13 |
|
| PDBID: | 9hdv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-13 |
|
| PDBID: | 9hdw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-13 |
|
| PDBID: | 9hdx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-13 |
|
| PDBID: | 9hdy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-13 |
|
| PDBID: | 9hdz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-13 |
|
| PDBID: | 9he4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-13 |
|
| PDBID: | 9hee | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of methionine gamma-lyase from Brevibacterium aurantiacum having disordered N-terminus and devoid of PLP cofactor | | Authors: | Kopecny, D., Ferchaud, N., Briozzo, P. | | Deposition date: | 2024-11-13 |
|
| PDBID: | 9he5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-13 |
|
