PDBID: | 9fyd | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-03 |
|
PDBID: | 9fy7 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-03 |
|
PDBID: | 9fyj | Status: | HPUB -- hold until publication | Title: | N-terminal domain of human galectin-8 in complex with an alpha-galactoside ligand | Authors: | Adrover Forteza, J., Puric, E., Nilsson, U.J., Anderluh, M., Logan, D.T. | Deposition date: | 2024-07-03 | Sequence: | >Entity 1 SLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSD
|
|
PDBID: | 9fy9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-03 |
|
PDBID: | 9cig | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-03 |
|
PDBID: | 9cif | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-03 |
|
PDBID: | 9cie | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-03 |
|
PDBID: | 9cid | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-03 |
|
PDBID: | 9cin | Status: | AUTH -- processed, waiting for author review and approval | Title: | Fab fragment of Antibody with NiV glycoprotein F | Authors: | Ouizougun-Oubari, M., Bajic, G. | Deposition date: | 2024-07-03 |
|
PDBID: | 9cim | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-03 |
|
PDBID: | 9cic | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-03 |
|
PDBID: | 9cib | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-03 |
|
PDBID: | 9cih | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-03 |
|
PDBID: | 9fxv | Status: | HPUB -- hold until publication | Title: | Influenza polymerase A C-terminal domain of PA subunit with peptide inhibitor containing two norleucines | Authors: | Radilova, K., Brynda, J. | Deposition date: | 2024-07-02 |
|
PDBID: | 9fxx | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Influenza polymerase A C-terminal domain of PA subunit with stapled peptide inhibitor | Authors: | Radilova, K., Brynda, J. | Deposition date: | 2024-07-02 |
|
PDBID: | 9fy1 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-02 |
|
PDBID: | 9fy2 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-02 |
|
PDBID: | 9fy3 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-02 |
|
PDBID: | 9fxo | Status: | AUTH -- processed, waiting for author review and approval | Title: | CRYO-EM STRUCTURE OF LEISHMANIA MAJOR 80S RIBOSOME WITH A/P/E-SITE TRNA AND MRNA : LM32CS1C1 M2 OE MUTANT | Authors: | Rajan, K.S., Yonath, A. | Deposition date: | 2024-07-02 |
|
PDBID: | 9fxy | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal Structure of Autotaxin (ENPP2) with Type IV Inhibitor | Authors: | Borza, R., Joosten, R.P., Perrakis, A. | Deposition date: | 2024-07-02 |
|
PDBID: | 9fxw | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal Structure of Autotaxin (ENPP2) with Type VI Inhibitor, a Novel Class of Inhibitors with Three-Point Lock Binding Mode | Authors: | Borza, R., Joosten, R.P., Perrakis, A. | Deposition date: | 2024-07-02 |
|
PDBID: | 9fxu | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal Structure of Autotaxin (ENPP2) with Type VI Inhibitor, a Novel Class of Inhibitors with Three-Point Lock Binding Mode | Authors: | Borza, R., Joosten, R.P., Perrakis, A. | Deposition date: | 2024-07-02 |
|
PDBID: | 9fx9 | Status: | HPUB -- hold until publication | Title: | CryoEM structure of RV-A89 | Authors: | Wald, J., Goessweiner-Mohr, N., Blaas, D., Marlovits, T.C. | Deposition date: | 2024-07-02 |
|
PDBID: | 9fxt | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-02 |
|
PDBID: | 9fy6 | Status: | HPUB -- hold until publication | Title: | Single particle cryo-EM reconstruction of Bacillus Methanolicus encapsulin nano compartment | Authors: | Marles-Wright, J., McIver, Z., Basle, A., Ross, J. | Deposition date: | 2024-07-02 |
|