| PDBID: | 9jwv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-10 |
|
| PDBID: | 9jwt | | Status: | HPUB -- hold until publication | | Title: | De novo designed D-allose binding protein based on 1rpj | | Authors: | Wang, X., Liu, Y. | | Deposition date: | 2024-10-10 |
|
| PDBID: | 9jww | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-10 |
|
| PDBID: | 7hk5 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-10-10 | | Release date: | 2025-10-10 |
|
| PDBID: | 7hk6 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-10-10 | | Release date: | 2025-10-10 |
|
| PDBID: | 7hk7 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-10-10 | | Release date: | 2025-10-10 |
|
| PDBID: | 7hk8 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-10-10 | | Release date: | 2025-10-10 |
|
| PDBID: | 7hk9 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-10-10 | | Release date: | 2025-10-10 |
|
| PDBID: | 7hka | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-10-10 | | Release date: | 2025-10-10 |
|
| PDBID: | 9jw9 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of YEATS domain of human YEATS2 in complex with LS-131 peptide | | Authors: | xinyi, Y. | | Deposition date: | 2024-10-10 |
|
| PDBID: | 9jwb | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-10 |
|
| PDBID: | 9jwk | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of FrCas9 in complex with sgRNA and 26-nt TS and 4-nt NTS substrates | | Authors: | Chen, S.D., Yang, M., Liu, S.Q. | | Deposition date: | 2024-10-10 |
|
| PDBID: | 9jwn | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of FrCas9 in complex with sgRNA and 43-bp dsDNA substrate | | Authors: | Chen, S.D., Yang, M., Liu, S.Q. | | Deposition date: | 2024-10-10 |
|
| PDBID: | 9jwu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-10 |
|
| PDBID: | 9h1l | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Methyl-coenzyme M reductase activation complex binding to the A2 component after incubation with ATP | | Authors: | Ramirez-Amador, F., Paul, S., Kumar, A., Schuller, J.M. | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9h1m | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-10-09 | | Release date: | 2025-04-09 |
|
| PDBID: | 9h1n | | Status: | HPUB -- hold until publication | | Title: | Dihydrolipoamide Acetyltransferase (E2) PSBD in complex with the Pyruvate Dehydrogenase (E1) binding domain from E. coli | | Authors: | Bothe, S.N., Racunica, D., Glockshuber, R. | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9h11 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9h0x | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9h12 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9h10 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9h1k | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-09 | | Release date: | 2025-10-09 |
|
| PDBID: | 9h0t | | Status: | HPUB -- hold until publication | | Title: | N terminal domain of BC2L-C lectin (1-131) in complex with a beta-fucosylamide side-product | | Authors: | Antonin, G., Varrot, A. | | Deposition date: | 2024-10-09 | | Sequence: | >Entity 1
GHMPLLSASIVSAPVVTSETYVDIPGLYLDVAKAGIRDGKLQVILNVPTPYATGNNFPGIYFAIATNQGVVADGCFTYSSKVPESTGRMPFTLVATIDVGSGVTFVKGQWKSVRGSAMHIDSYASLSAIWGTAA
|
|
| PDBID: | 9h0u | | Status: | HPUB -- hold until publication | | Title: | N terminal domain of BC2L-C lectin (1-131) with covalent beta-fucosylamide ligand | | Authors: | Antonini, G., Varrot, A. | | Deposition date: | 2024-10-09 | | Sequence: | >Entity 1
GHMPLLSASIVSAPVVTSETYVDIPGLYLDVAKAGIRDGKLQVILNVPTPYATGNNFPGIYFAIATNQGVVADGCFTYSSKVPESTGRMPFTLVATIDVGSGVTFVKGQWKSVRGSAMHIDSYASLSAIWGTAA
|
|
| PDBID: | 9h13 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-09 |
|
