| PDBID: | 9m1l | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the TBC-DE-Arl2-alpha-beta-tubulin complex with GTP | | Authors: | Seong, Y.J., Kim, H.M., Byun, K.M., Park, Y.W., Roh, S.H. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9m1s | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9m21 | | Status: | HPUB -- hold until publication | | Title: | GmMAN19-1 from Glycine max in complex with mannopentaose | | Authors: | Lin, C.J., Hsu, C.H. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9m1y | | Status: | HPUB -- hold until publication | | Title: | NMR Structure of Mouse Keratin 17 Tail Domain (G390 - R433) in solution | | Authors: | Yeom, J., Lee, C.H., Kim, J.H. | | Deposition date: | 2025-02-26 | | Sequence: | >Entity 1
GSTGEDAHLTQYKPKEPVTTRQVRTIVEEVQDGKVISSREQVHQTTR
|
|
| PDBID: | 9m1r | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nin | | Status: | HPUB -- hold until publication | | Title: | The structure of human Vacuolar Protein Sorting 34 catalytic domain bound to RD-I-86 | | Authors: | Cartwright, J.J., Abiodun, W.O., Dass, R., Singleton, J.D., Doukov, T., Peterson, M.A., Moody, J.D. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nj2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nj0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nij | | Status: | HPUB -- hold until publication | | Title: | Structure of the acyltransferase domain of NcdE, a multi-domain NRPS protein from nocardichelin biosynthesis | | Authors: | Fisk, M.B., Gulick, A.M. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nik | | Status: | HPUB -- hold until publication | | Title: | Structure of E1277A mutant of the acyltransferase domain of NcdE, a multi-domain NRPS protein from nocardichelin biosynthesis | | Authors: | Fisk, M.B., Gulick, A.M. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nil | | Status: | HPUB -- hold until publication | | Title: | Structure of a Y1216F mutant of the acyltransferase domain of NcdE, a multi-domain NRPS protein from nocardichelin biosynthesis | | Authors: | Fisk, M.B., Gulick, A.M., Barrera Ramirez, J. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nim | | Status: | HPUB -- hold until publication | | Title: | Structure of a K1305A mutant of the acyltransferase domain of NcdE, a multi-domain NRPS protein from nocardichelin biosynthesis | | Authors: | Fisk, M.B., Gulick, A.M., Barrera Ramirez, J. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nid | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nie | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nif | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nix | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-02-26 | | Release date: | 2026-02-26 |
|
| PDBID: | 9nip | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-26 | | Release date: | 2026-02-26 |
|
| PDBID: | 9niz | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-02-26 | | Release date: | 2026-02-26 |
|
| PDBID: | 9nis | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nio | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9niv | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nj8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nj1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nj4 | | Status: | HPUB -- hold until publication | | Title: | Fab1437 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein | | Authors: | Moskovitz, R., Wilson, I.A. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nj6 | | Status: | HPUB -- hold until publication | | Title: | Computationally optimized broadly reactive influenza B hemagglutinin BC2 bound by antibody #3978 | | Authors: | Dzimianski, J.V., Kunkel, I., Balasco Serrao, V.H., DuBois, R.M. | | Deposition date: | 2025-02-26 |
|
