| PDBID: | 9nnb | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9nnh | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9nnd | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9nn7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9nn8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9nng | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of SARS-CoV-2 main protease V186I covalently bound to inhibitor GRL-051-22 at 1.90 A | | Authors: | Beechboard, S.N., Ghosh, A.K., Mesecar, A.D., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2025-03-05 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFIDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
| PDBID: | 9nnn | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of amyloid fibril extracted from the heart of a variant ATTR D38A amyloidosis patient | | Authors: | Nguyen, B., Afrin, S., Saelices, L. | | Deposition date: | 2025-03-05 | | Release date: | 2026-03-05 |
|
| PDBID: | 9nne | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9nnk | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9nni | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9nnj | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9nnm | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9nno | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9nnp | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9qch | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Complex of Ovine Serum Albumin with Cephalosporin C | | Authors: | Duszynski, K., Talaj, J.A., Bujacz, A., Bujacz, G. | | Deposition date: | 2025-03-04 |
|
| PDBID: | 9qc2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-04 |
|
| PDBID: | 9qc8 | | Status: | AUCO -- author corrections pending review | | Deposition date: | 2025-03-04 |
|
| PDBID: | 9qc6 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-04 |
|
| PDBID: | 9qc7 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-04 |
|
| PDBID: | 9qcn | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | HA70 complex from Clostridium botulinum Serotype B1 | | Authors: | Krc, A., Persson Kosenina, S., Masuyer, G., Stenmark, P. | | Deposition date: | 2025-03-04 |
|
| PDBID: | 9qco | | Status: | AUCO -- author corrections pending review | | Deposition date: | 2025-03-04 |
|
| PDBID: | 9qce | | Status: | AUCO -- author corrections pending review | | Deposition date: | 2025-03-04 |
|
| PDBID: | 9qcm | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-04 |
|
| PDBID: | 9qc1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the neurotensin receptor 1 in complex with the small-molecule full agonist cp28a | | Authors: | Deluigi, M., Hilge, M., Plueckthun, A. | | Deposition date: | 2025-03-04 |
|
| PDBID: | 9qcd | | Status: | PROC -- to be processed | | Title: | Micro-ED structure of the NSH2-CSH2 tandem domain of SHP2 in complex with the bis-phosphorylated pY627-pY659-Gab1 (613-694) peptide | | Authors: | Machner, L., Shaikhqasem, A., Hamdi, F., Breithaupt, C., Parthier, C., Kyrilis, F.L., Kastritis, P.L., Feller, S.M., Stubbs, M.T. | | Deposition date: | 2025-03-04 |
|
