PDBID: | 8xgi | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8xgl | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8xgp | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8xgo | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-12-15 |
|
PDBID: | 8xgn | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8xgq | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8xgs | Status: | HPUB -- hold until publication | Title: | a peptide receptor complex structure | Authors: | Wu, Z., Du, Y., Chen, G. | Deposition date: | 2023-12-15 |
|
PDBID: | 8xgu | Status: | HPUB -- hold until publication | Title: | a peptide receptor complex structure | Authors: | Wu, Z., Du, Y., Chen, G. | Deposition date: | 2023-12-15 |
|
PDBID: | 8xgg | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-12-15 |
|
PDBID: | 8rgm | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of nucleosome containing Widom603 DNA | Authors: | Motorin, N.A., Afonin, D., Armeev, G.A., Moiseenko, A., Zhao, L., Vasiliev, V., Oleinikov, P., Shaytan, A., Shi, X., Studitsky, V., Sokolova, O. | Deposition date: | 2023-12-14 |
|
PDBID: | 8rgn | Status: | HPUB -- hold until publication | Title: | BmrA E504-R6G-70uMATPMg | Authors: | Gobet, A., Zarkadas, E., Schoehn, G., Falson, P., Chaptal, V. | Deposition date: | 2023-12-14 |
|
PDBID: | 8rgu | Status: | HPUB -- hold until publication | Title: | Arginase 2 in complex with inhibitor | Authors: | Petersen, J. | Deposition date: | 2023-12-14 |
|
PDBID: | 8rh5 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-12-14 |
|
PDBID: | 8rgx | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 8vcm | Status: | HPUB -- hold until publication | Title: | Crystal structure of rMcL-1 in complex with galactose | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | Deposition date: | 2023-12-14 | Sequence: | >Entity 1 GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
PDBID: | 8vco | Status: | HPUB -- hold until publication | Title: | Crystal structure of rMcL-1 in complex with N-acetyl-D-galactosamine | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | Deposition date: | 2023-12-14 | Sequence: | >Entity 1 GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
PDBID: | 8vcp | Status: | HPUB -- hold until publication | Title: | Crystal structure of dimeric rMcL-1 in complex with raffinose | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | Deposition date: | 2023-12-14 | Sequence: | >Entity 1 GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
PDBID: | 8vcs | Status: | HPUB -- hold until publication | Title: | Crystal structure of the oligomeric rMcL-1 in complex with lactose | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | Deposition date: | 2023-12-14 | Sequence: | >Entity 1 GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
PDBID: | 8vcq | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of the oligomeric rMcL-1 in complex with raffinose | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | Deposition date: | 2023-12-14 |
|
PDBID: | 8vcu | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of the oligomeric rMcL-1 in complex with lactulose | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | Deposition date: | 2023-12-14 |
|
PDBID: | 8vck | Status: | HPUB -- hold until publication | Title: | Galactose-binding lectin from Mytilus californianus, Isoform 1 (rMcL-1) | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | Deposition date: | 2023-12-14 | Sequence: | >Entity 1 GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
PDBID: | 8vcg | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 8vcf | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 8vcl | Status: | HPUB -- hold until publication | Title: | Crystal structure of HLA-A*03:01 in complex with a mutant PIK3CA peptide | Authors: | Ma, J., Baker, B.M. | Deposition date: | 2023-12-14 |
|
PDBID: | 8vcv | Status: | HPUB -- hold until publication | Title: | Lineage IV Lassa virus glycoprotein (Josiah) in complex with rabbit polyclonal antibody (GPC-C epitope) | Authors: | Brouwer, P.J.M., Perrett, H.R., Ward, A.B. | Deposition date: | 2023-12-14 |
|