| PDBID: | 8vit | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the N-terminal domain of fatty acid kinase A (FakA) from Staphylococcus aureus (Mg and ADP) | | Authors: | Lovell, S., Kashipathy, M.M., Battaile, K.P., Bose, J.L. | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8viz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8vio | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8xqv | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD-YH23025 complex | | Authors: | Dong, J., Lin, H.-Y., Yang, G.-F. | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8xqc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8xqg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8xqh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8xqi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8xqj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8xr1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8xqe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8xqf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8xqz | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD-NHPA complex | | Authors: | Dong, J., Lin, H.-Y., Yang, G.-F. | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8xr0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD-YH21618 complex | | Authors: | Dong, J., Lin, H.-Y., Yang, G.-F. | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8rm0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8rly | | Status: | HPUB -- hold until publication | | Title: | E. coli endonuclease IV complexed with sulfate, catalytic Fe2+ | | Authors: | Saper, M.A., Paterson, N.G., Kirillov, S., Rouvinski, A. | | Deposition date: | 2024-01-04 | | Sequence: | >Entity 1
MKYIGAHVSAAGGLANAAIRAAEIDATAFALFTKNQRQWRAAPLTTQTIDEFKAACEKYHYTSAQILPHDSYLINLGHPVTEALEKSRDAFIDEMQRCEQLGLSLLNFHPGSHLMQISEEDCLARIAESINIALDKTQGVTAVIENTAGQGSNLGFKFEHLAAIIDGVEDKSRVGVCIDTCHAFAAGYDLRTPAECEKTFADFARTVGFKYLRGMHLNDAKSTFGSRVDRHHSLGEGNIGHDAFRWIMQDDRFDGIPLILETINPDIWAEEIAWLKAQQTEKAVA
|
|
| PDBID: | 8rm1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8rlz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8rlw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8rm3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ferrioxamine transporter FoxA | | Authors: | Josts, I., Tidow, H., Mislin, G. | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8rlx | | Status: | HPUB -- hold until publication | | Title: | Erk2 MAP kinase T188A mutant | | Authors: | Livnah, O., Gutman, D. | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8rm2 | | Status: | HPUB -- hold until publication | | Title: | Erk2 MAP kinase T188E mutant | | Authors: | Livnah, O., Gutman, D. | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8vim | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8xpp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8xpo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
