| PDBID: | 8ys0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8ys3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of rat thioredoxin, F54L mutant | | Authors: | Takeshita, K., Baba, T., Ohe, C., Saji, S., Yamamoto, S., Yamamoto, M., Ouchida, M., Kawasaki-Ohmori, I. | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8ysc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8ysd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8ysf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8yse | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8ysg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8ys7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of actinomycin D and Echinomycin-d(ACGGGCT/AGCCCCGT) complex | | Authors: | Lee, Y.Y., Hou, M.H. | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8ys1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of rat thioredoxin, Wild-type | | Authors: | Baba, T., Ueno, G., Ohe, C., Saji, S., Yamamoto, S., Yamamoto, M., Ouchida, M., Kawasaki-Ohmori, I., Takeshita, K. | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8ys9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 9b52 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 9b53 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 9b5y | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 9b54 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Biased agonist bound CB1-Gi structure | | Authors: | Rangari, V.A., O''Brien, E.S., Kobilka, B.K., Krishna Kumar, K., Majumdar, S. | | Deposition date: | 2024-03-22 |
|
| PDBID: | 9er8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 9er4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 9eqw | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Human Picobirnavirus CP Reassembled VLP | | Authors: | Rodriguez-Espinosa, M.J., Novoa, G., Martinez-Romero, J.M., de Pablo, P.J., Caston, J.R. | | Deposition date: | 2024-03-22 |
|
| PDBID: | 9erd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 9ere | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 9erf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 9er2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 9eqn | | Status: | HPUB -- hold until publication | | Title: | N-terminal domain of Infectious Bursal Disease Virus (IBDV) VP3 | | Authors: | Ferrero, D.S., Verdaguer, N. | | Deposition date: | 2024-03-22 |
|
| PDBID: | 9eqo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 9eqp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 9eqr | | Status: | HPUB -- hold until publication | | Title: | 8fs pulse duration 50uJ pulse energy thaumatin | | Authors: | Owen, R.L., Hough, M.A., Worrall, J., Williams, L. | | Deposition date: | 2024-03-22 | | Sequence: | >Entity 1
ATFEIVNRCSYTVWAAASKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSGSGICKTGDCGGLLRCKRFGRPPTTLAEFSLNQYGKDYIDISNIKGFNVPMDFSPTTRGCRGVRCAADIVGQCPAKLKAPGGGCNDACTVFQTSEYCCTTGKCGPTEYSRFFKRLCPDAFSYVLDKPTTVTCPGSSNYRVTFCPTA
|
|
