PDBID: | 9f5i | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-28 |
|
PDBID: | 9f58 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-28 |
|
PDBID: | 9f4i | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-28 |
|
PDBID: | 9f56 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-28 |
|
PDBID: | 9f5a | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-28 |
|
PDBID: | 8zbx | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of aldehyde dehydrogenase 2C4 (Os ALDH2C4) from Oryza sativa L. | Authors: | Wang, Y., Wang, W.M., Song, Z.D. | Deposition date: | 2024-04-28 | Release date: | 2025-04-28 |
|
PDBID: | 8zbv | Status: | HPUB -- hold until publication | Title: | alpha-L-fucosidase from Pontiella sulfatireligans F21 | Authors: | Zhao, P., Bai, L., Wang, S. | Deposition date: | 2024-04-28 |
|
PDBID: | 8zbw | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-28 |
|
PDBID: | 8zc7 | Status: | HPUB -- hold until publication | Title: | Crystallographic analysis of MitM, which catalyzes the post-mitosane modification in mitomycin biosynthesis | Authors: | Xia, M., Dong, D. | Deposition date: | 2024-04-28 |
|
PDBID: | 8zc8 | Status: | HPUB -- hold until publication | Title: | The structure of MitM and mitomycin A with SAH in mitomycin | Authors: | Xia, M., Dong, D. | Deposition date: | 2024-04-28 |
|
PDBID: | 9f4c | Status: | HPUB -- hold until publication | Title: | Structure of the C-terminal domain of CKAP5/chTOG | Authors: | Pfuhl, M. | Deposition date: | 2024-04-27 | Sequence: | >Entity 1 ASRIDEKSSKAKVNDFLAEIFKKIGSKENTKEGLAELYEYKKKYSDADIEPFLKNSSQFFQSYVERGLRVIEMEREGKGRISTSTGISPQMEVTCVPTPTSTVSSIGNTNGEEVGPSVYLERLKILRQRCGLDNTKQDDRP
|
|
PDBID: | 8zbr | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-27 |
|
PDBID: | 8zbp | Status: | AUTH -- processed, waiting for author review and approval | Title: | The crystal structure of SARS-CoV-2 main protease in complex with Compound ZM_097 | Authors: | Zhao, Y. | Deposition date: | 2024-04-27 |
|
PDBID: | 8zbs | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-27 |
|
PDBID: | 8zbt | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-27 |
|
PDBID: | 8zbq | Status: | HPUB -- hold until publication | Title: | Local map of Omicron Subvariant JN.1 RBD with ACE2 | Authors: | Yan, R.H., Yang, H.N. | Deposition date: | 2024-04-27 |
|
PDBID: | 8zbu | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-27 |
|
PDBID: | 9f3u | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-26 |
|
PDBID: | 9f47 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-26 |
|
PDBID: | 9f49 | Status: | HOLD -- hold until a certain date | Title: | Structure of the bacteriophage K gp155 C-terminal domain, seleno-methionine modified version | Authors: | Pichel, A., van Raaij, M.J. | Deposition date: | 2024-04-26 | Release date: | 2024-06-21 | Sequence: | >Entity 1 KDF(MSE)LIGHRGATGYTDEHTIKGYQ(MSE)ALDKGADYIELDLQLTKDNKLLC(MSE)HDSTIDRTTTGTGKVGD(MSE)TLSYIQTNFTSLNGEPIPSLDDVLNHFGTKVKYYIETKRPFDAN(MSE)DRELLTQLKAKGLIGIGSERFQVIIQSFARESLINIHNQFSNIPLAYLTSTFSESE(MSE)DDCLSYGFYAIAPKYTTITKELVDLAHSKGLKVHAWTVNTKEE(MSE)QSLIQ(MSE)GVDGFFTNYLDEYKKI
|
|
PDBID: | 9f4b | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-26 |
|
PDBID: | 9f4a | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-26 |
|
PDBID: | 9f3v | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-26 |
|
PDBID: | 9f46 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-26 |
|
PDBID: | 8zb4 | Status: | HPUB -- hold until publication | Title: | Crystal structure of NudC from Mycobacterium abscessus in complex with NAD | Authors: | Meng, L., Zhang, Y., Xu, J., Liu, J. | Deposition date: | 2024-04-26 |
|