| PDBID: | 9ejw | | Status: | HPUB -- hold until publication | | Title: | MCMV immunoevasin m11 binding murine CD44 | | Authors: | Deuss, F.A., Rossjohn, J., Sng, X.Y.X., Voigt, V., Schuster, I.S., Fleming, P., Abuwarwar, M., van Dommelen, S., Neate, G., Horsnell, H.L., Golzarroshan, B., Varelias, A., Hill, G.R., Lyman, S.D., Mueller, S.N., Scalzo, A.A., Wikstrom, M.E., Berry, R., Fletcher, A.L., Andoniou, C.E., Degli-Esposti, M.A. | | Deposition date: | 2024-11-29 |
|
| PDBID: | 9hjd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-28 |
|
| PDBID: | 9hj9 | | Status: | HPUB -- hold until publication | | Title: | H1-H3 chimeric hemagglutinin | | Authors: | Seraj, N., Harshbarger, W., Mallett, C.P., Vassilev, V. | | Deposition date: | 2024-11-28 | | Sequence: | >Entity 1
APLQLGNCSVAGWILGNPECELLISRESWSYIVEKPNPENGTCYPGHFADYEELREQLSSVSSFERFEIFPKESSWPNHTQNGGSNSCSHNGESSFYKNLLWLTKSGSLYPNLSKSYANNKEKEVLVLWGVHHPPTIQEQTSLYVKENAYVSVVSSHYSRKFTPEIAKRPKVRDQEGRINYYWTLLEPGDTIIFEANGNLIAPRYAFALSRGSGLVPRGSGHHHHHH
>Entity 2
MGCVAETGQVQLEESGPGLVKPSETLSLTCSVSGVSVTSDIYYWTWIRQPPGKGLEWIGYIFYNGDTNYNPSLKSRVTMSIDTSKNEFSLRLTSVTAADTAVYFCARGTEDLGYCSSGSCPNHWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC
>Entity 3
MGCVAETGDIVMTQSPSSLSASIGDRVTITCRPSQNIRSFLNWFQHKPGKAPKLLIYAASNLQSGVPSRFSGSGSGTEFTLTIRSLQPEDFATYYCQQSYNTPPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
|
|
| PDBID: | 9hj5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-28 |
|
| PDBID: | 9hjb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-28 |
|
| PDBID: | 9hje | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-28 |
|
| PDBID: | 9hj7 | | Status: | HPUB -- hold until publication | | Title: | Structure of Chitinase 35 from Metschnikowia pulcherrima (MpChit35) | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-11-28 |
|
| PDBID: | 9hja | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-28 |
|
| PDBID: | 9krp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-28 |
|
| PDBID: | 9krx | | Status: | HPUB -- hold until publication | | Title: | Membrane-Abeta40 fibril structure | | Authors: | Liu, W., Yang, J., Chang, Z. | | Deposition date: | 2024-11-28 |
|
| PDBID: | 9krt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-28 |
|
| PDBID: | 9kru | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-28 |
|
| PDBID: | 9krv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-28 |
|
| PDBID: | 9krl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-28 |
|
| PDBID: | 9krm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-28 |
|
| PDBID: | 9krn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-28 |
|
| PDBID: | 9krk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-28 |
|
| PDBID: | 9krj | | Status: | HPUB -- hold until publication | | Title: | Structure of mouse Dyrk1a | | Authors: | Kim, K. | | Deposition date: | 2024-11-28 |
|
| PDBID: | 9krw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-28 |
|
| PDBID: | 9ejs | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-28 |
|
| PDBID: | 9ejj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-28 | | Sequence: | >Entity 1
MKNAPSTAGGGYGSWEIDPKDLTFLKELGTGQFGVVKYGKWRGQYDVAIKMIREGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANGCLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDFGLSRYVLDDEETSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLPRPHLASERVYTIMYSCWHEKADERPSFKILLSNILDVMDEES
|
|
| PDBID: | 9ejr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-28 |
|
| PDBID: | 9hiz | | Status: | HPUB -- hold until publication | | Title: | Complex of the Nanofitin Sac7d-C3(C24A) with a human IgG1 Fc fragment | | Authors: | Eichinger, A., Skerra, A. | | Deposition date: | 2024-11-27 |
|
| PDBID: | 9hip | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-27 |
|
| PDBID: | 9hiq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-27 |
|
