| PDBID: | 9hkc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of IMPDH from Burkholderia thailandensis | | Authors: | Gelin, M., Labesse, G., Ayoub, N., Haouz, A., Munier-Lehmann, H. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9hk8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of IMPDH from Burkholderia thailandensis | | Authors: | Gelin, M., Labesse, G., Ayoub, N., Haouz, A., Munier-Lehmann, H. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9hkp | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9hkn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ku3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ku1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9kty | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the TIA-1 prion-like domain amyloid fibril, WT | | Authors: | Inaoka, D., Miyata, T., Makino, F., Ohtani, Y., Ekari, M., Kobayashi, R., Imamura, K., Sakamoto, E., Kodama, S.T., Yoshida, N., Kato, T., Namba, K., Tochio, H., Sekiyama, N. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ktz | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the TIA-1 prion-like domain amyloid fibril, G355R | | Authors: | Inaoka, D., Miyata, T., Makino, F., Ohtani, Y., Ekari, M., Kobayashi, R., Imamura, K., Sakamoto, E., Kodama, S.T., Yoshida, N., Kato, T., Namba, K., Tochio, H., Sekiyama, N. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ku5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ku7 | | Status: | HPUB -- hold until publication | | Title: | complex structure of methyltransferases SMYD2 and inhibitor (17) | | Authors: | Sun, Y.L., Lu, J., Zhao, K.H., Lu, W.C. | | Deposition date: | 2024-12-03 | | Sequence: | >Entity 1
GRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
|
|
| PDBID: | 9ku8 | | Status: | HPUB -- hold until publication | | Title: | Solution NMR structure of P1 peptide bound with E. coli LPS | | Authors: | Mohid, S.A., Bhunia, A. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ktu | | Status: | HPUB -- hold until publication | | Title: | Structure of TauT in complex with beta-alanine | | Authors: | Yin, Y.X., Lu, Y.S., Ding, D. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ktv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ktw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ktx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ku4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9kub | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of CtpA from Helicobacter pylori in conformation I | | Authors: | Sun, K., Zhang, H., Au, S.W.N. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9kuc | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of CtpA from Helicobacter pylori in conformation II | | Authors: | Sun, K., Zhang, H., Au, S.W.N. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9kua | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9kud | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 JN.1 variant RBD complexed with squirrel ACE2 | | Authors: | Lan, J., Wang, C.H. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9kuh | | Status: | HPUB -- hold until publication | | Title: | Co-crystal structure of wild-type OYE2 with 2-(prop-1-en-2-yl)pyridine | | Authors: | Wu, D.S., Yang, J. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9kug | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ku0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9eko | | Status: | HPUB -- hold until publication | | Title: | A chimeric hybrid protein fused with the FGFR3 Transmembrane Domain | | Authors: | Yu, Z., Kreitler, D.F., Gellman, S.H. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ekr | | Status: | HPUB -- hold until publication | | Title: | Human Hsp27 alpha-crystallin domain (84-171) R136W in complex with a peptide mimic of its C-terminus | | Authors: | Benesch, J.L.P., Allison, T.M., Gastall, H., Laganowsky, A. | | Deposition date: | 2024-12-03 |
|
