| PDBID: | 9ewp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-04 |
|
| PDBID: | 9ewl | | Status: | HPUB -- hold until publication | | Title: | The sTeLIC pentameric Ligand-Gated Ion Channel (wild-type) in complex with 4-bromoamphetamine | | Authors: | Fourati, Z., Delarue, M. | | Deposition date: | 2024-04-04 |
|
| PDBID: | 9ewr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-04 |
|
| PDBID: | 9ewu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-04 |
|
| PDBID: | 8yyv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-04 |
|
| PDBID: | 8yyu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-04 |
|
| PDBID: | 8yyw | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of OXGR1 bound to alpha-ketoglutarate and Gq proteins | | Authors: | Liu, A., Liu, Y. | | Deposition date: | 2024-04-04 |
|
| PDBID: | 8yyx | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of OXGR1 bound to leukotriene E4 and Gq proteins | | Authors: | Liu, A., Liu, Y. | | Deposition date: | 2024-04-04 |
|
| PDBID: | 8yyp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PtmB in complex with cyclo-(L-Trp-L-Trp) and Adenine | | Authors: | Zhang, Z.Y., Qu, X.D., Duan, B.R., Wei, G.Z. | | Deposition date: | 2024-04-04 |
|
| PDBID: | 8yyl | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the complex IR with one insulin | | Authors: | Xi, Z. | | Deposition date: | 2024-04-04 |
|
| PDBID: | 8yyy | | Status: | HPUB -- hold until publication | | Title: | Viral protein | | Authors: | Suzuki, T., Yanagi, Y., Hashiguchi, T. | | Deposition date: | 2024-04-04 |
|
| PDBID: | 8yyt | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the complex IR with four insulin | | Authors: | Xi, Z. | | Deposition date: | 2024-04-04 |
|
| PDBID: | 8yys | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the complex IR with two insulin | | Authors: | Xi, Z. | | Deposition date: | 2024-04-04 |
|
| PDBID: | 8yyz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-04 |
|
| PDBID: | 8yym | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-04 |
|
| PDBID: | 8yy3 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-03 | | Release date: | 2025-04-03 |
|
| PDBID: | 9b9p | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 | | Sequence: | >Entity 1
MTTVYYDQDVKTDALQGKKIAVVGYGSQGHAHAQNLKDNGYDVVIGIRPGRSFDKAKEDGFDVFPVAEAVKQADVIMVLLPDEIQGDVYKNEIEPNLEKHNALAFAHGFNIHFGVIQPPADVDVFLVAPKGPGHLVRRTFVEGSAVPSLFGIQQDASGQARNIALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGVSKLIQSGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGMENVRYSISNTAEFGDYVSGPRVITPDVKENMKAVLTDIQNGNFSNRFIEDNKNGFKEFYKLREEQHGHQIEKVGRELREMMPFIKSKSIEKHHHHHH
|
|
| PDBID: | 9b9z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ba0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9bae | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9b9u | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | SARS CoV-2 full-length spike protein with His1271Lys substitution in the coatomer binding motif, 1RBD-up conformation | | Authors: | Singh, S., Hasan, S.S. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9b9s | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9b9x | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ba3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ba8 | | Status: | HPUB -- hold until publication | | Title: | O-GlcNAcase (OGA) inhibitor complex for the Treatment of Alzheimer''s Disease | | Authors: | Hendle, J., Romero, R. | | Deposition date: | 2024-04-03 |
|
