PDBID: | 9mnq | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of Hepatitis C virus envelope glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM10-30 | Authors: | Nguyen, T.K.Y., Wilson, I.A. | Deposition date: | 2024-12-23 |
|
PDBID: | 9mnt | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of Hepatitis C virus envelope glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM1-73 | Authors: | Nguyen, T.K.Y., Stanfield, R.L., Wilson, I.A. | Deposition date: | 2024-12-23 |
|
PDBID: | 9mns | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of Hepatitis C virus envelope glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM1-36 | Authors: | Nguyen, T.K.Y., Stanfield, R.L., Wilson, I.A. | Deposition date: | 2024-12-23 |
|
PDBID: | 9mnu | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of Hepatitis C virus envelope glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM11-48 | Authors: | Nguyen, T.K.Y., Stanfield, R.L., Wilson, I.A. | Deposition date: | 2024-12-23 |
|
PDBID: | 9hum | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-12-23 | Release date: | 2025-12-23 |
|
PDBID: | 9hur | Status: | HPUB -- hold until publication | Title: | Crystal structure of Tetraspanin CD63mutant Large Extracellular Loop (LEL) in complex with sybody LA4 | Authors: | Nagarathinam, K., Krey, T. | Deposition date: | 2024-12-23 |
|
PDBID: | 9hup | Status: | HPUB -- hold until publication | Title: | Trypanosoma brucei PTR1 (TbPTR1) in complex with inhibitor F194 | Authors: | Landi, G., Pozzi, C., Mangani, S. | Deposition date: | 2024-12-23 | Sequence: | >Entity 1 MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQP(CSX)MAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
PDBID: | 9huo | Status: | HPUB -- hold until publication | Title: | A01 mAbs bound to cobratoxin at pH 5.5 | Authors: | Wade, J.W., Bohn, M.F., Laustsen, A.H., Morth, J.P. | Deposition date: | 2024-12-23 |
|
PDBID: | 9hv1 | Status: | HPUB -- hold until publication | Title: | Crystal structure of tri-specific FMDV mAb-17 Fab | Authors: | Ren, J., Duyvesteyn, H.M.E., Stuart, D.I. | Deposition date: | 2024-12-23 |
|
PDBID: | 7hqs | Status: | HPUB -- hold until publication | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z56912586 | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | Deposition date: | 2024-12-23 |
|
PDBID: | 7hqt | Status: | HPUB -- hold until publication | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z104503564 | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | Deposition date: | 2024-12-23 |
|
PDBID: | 7hqu | Status: | HPUB -- hold until publication | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z969591530 | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | Deposition date: | 2024-12-23 |
|
PDBID: | 7hqv | Status: | HPUB -- hold until publication | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z104477750 | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | Deposition date: | 2024-12-23 |
|
PDBID: | 7hqw | Status: | HPUB -- hold until publication | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z431953146 | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | Deposition date: | 2024-12-23 |
|
PDBID: | 7hqx | Status: | HPUB -- hold until publication | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z218760918 | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | Deposition date: | 2024-12-23 |
|
PDBID: | 7hqy | Status: | HPUB -- hold until publication | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z1117899682 | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | Deposition date: | 2024-12-23 |
|
PDBID: | 7hqz | Status: | HPUB -- hold until publication | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z62452555 | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | Deposition date: | 2024-12-23 |
|
PDBID: | 7hr0 | Status: | HPUB -- hold until publication | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z607808530 | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | Deposition date: | 2024-12-23 |
|
PDBID: | 7hr1 | Status: | HPUB -- hold until publication | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z57036327 | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | Deposition date: | 2024-12-23 |
|
PDBID: | 7hr6 | Status: | HPUB -- hold until publication | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z104495736 | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | Deposition date: | 2024-12-23 |
|
PDBID: | 7hr7 | Status: | HPUB -- hold until publication | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z57493539 | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | Deposition date: | 2024-12-23 |
|
PDBID: | 7hr8 | Status: | HPUB -- hold until publication | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z104501152 | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | Deposition date: | 2024-12-23 |
|
PDBID: | 7hr9 | Status: | HPUB -- hold until publication | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z57984669 | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | Deposition date: | 2024-12-23 |
|
PDBID: | 7hra | Status: | HPUB -- hold until publication | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z45415581 | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | Deposition date: | 2024-12-23 |
|
PDBID: | 7hrb | Status: | HPUB -- hold until publication | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z106939542 | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | Deposition date: | 2024-12-23 |
|