| PDBID: | 8ydw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8ydn | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-02-21 | | Release date: | 2025-02-21 |
|
| PDBID: | 8ydz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8ydy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8ydx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8ye3 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human respiratory syncytial virus fusion protein variant | | Authors: | Li, Q.M., Su, J.G., Zhang, J., Liang, Y., Shao, S., Li, X.Y., Zhao, Z.X. | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8ye1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8ye2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8ydt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8s42 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 80 (1124898) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8s4d | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8s4l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8s4f | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 | | Sequence: | >Entity 1
MSPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 8s4j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8s43 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8s4o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8s4h | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8s4e | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8s4k | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8s4i | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8s4m | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Mycobacterium tuberculosis cytochrome P450 CYP125 in complex with an inhibitor | | Authors: | Snee, M., Kavanagh, M., Levy, C. | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8s4n | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8s44 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8w2y | | Status: | HPUB -- hold until publication | | Title: | Structure and interactions of HIV-1 gp41 CHR-NHR reverse hairpin constructs reveal molecular determinants of antiviral activity | | Authors: | McAndrew, R.P., Ralston, C.Y., Gochin, M. | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8w32 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
