| PDBID: | 8vlz | | Status: | HOLD -- hold until a certain date | | Title: | CryoEM structure of human S-OPA1 assembled on lipid membrane containing brominated cardiolipin in membrane-adjacent state | | Authors: | Zuccaro, K.E., Aydin, H. | | Deposition date: | 2024-01-12 | | Release date: | 2025-01-12 |
|
| PDBID: | 7gyl | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-12 |
|
| PDBID: | 8vm1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structural Elucidation of the Mesothelin Mucin16 CA125 Interaction | | Authors: | Rupert, P.B., Strong, R. | | Deposition date: | 2024-01-12 |
|
| PDBID: | 7gym | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-12 |
|
| PDBID: | 8vlt | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of glycan-targeting antibody 2526 Fab bound to Mannose | | Authors: | Lindenberger, J., Acharya, P. | | Deposition date: | 2024-01-12 | | Release date: | 2025-01-12 |
|
| PDBID: | 7gyn | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-12 |
|
| PDBID: | 8vm0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-12 |
|
| PDBID: | 7gyo | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-12 |
|
| PDBID: | 8vm4 | | Status: | HOLD -- hold until a certain date | | Title: | CryoEM structure of human S-OPA1 assembled on lipid membrane containing brominated cardiolipin in membrane-adjacent state | | Authors: | Zuccaro, K.E., Aydin, H. | | Deposition date: | 2024-01-12 | | Release date: | 2025-01-12 |
|
| PDBID: | 7gyp | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-12 |
|
| PDBID: | 8vm5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-12 |
|
| PDBID: | 7gyq | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-12 |
|
| PDBID: | 7gyr | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-12 |
|
| PDBID: | 7gys | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-12 |
|
| PDBID: | 7gyt | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-12 |
|
| PDBID: | 7gyx | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-12 |
|
| PDBID: | 7gyu | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-12 |
|
| PDBID: | 7gyv | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-12 |
|
| PDBID: | 7gyw | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-12 |
|
| PDBID: | 8xtl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8xtt | | Status: | HOLD -- hold until a certain date | | Title: | Nuclear receptor Nor1 ligand binding domain | | Authors: | Yoo, J.Y., Yoon, H.S. | | Deposition date: | 2024-01-11 | | Release date: | 2025-01-11 | | Sequence: | >Entity 1
KSPLQQEPSQPSPPSPPICMMNALVRALTDSTPRDLDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFVLRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSLNLQSLNLDIQALACLSALSMITERHGLKEPKRVEELCNKITSSLKDHQSKGQALEPTESKVLGALVELRKICTLGLQRIFYLKLEDLVSPPSIIDKLFLDTLPF
|
|
| PDBID: | 8xto | | Status: | HOLD -- hold until a certain date | | Title: | Human Keratin 19 head domain segment L18-G38 in solution | | Authors: | Jeong, M., Ji, Y., Kim, J., Lee, C.H. | | Deposition date: | 2024-01-11 | | Release date: | 2025-01-11 | | Sequence: | >Entity 1
LGGGSVRFGPGVAFRAPSIHG
|
|
| PDBID: | 8xtn | | Status: | HOLD -- hold until a certain date | | Title: | Human Keratin 19 head domain segment Y6-G38 in solution | | Authors: | Jeong, M., Ji, Y., Kim, J., Lee, C.H. | | Deposition date: | 2024-01-11 | | Release date: | 2025-01-11 | | Sequence: | >Entity 1
YRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHG
|
|
| PDBID: | 8xtu | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Rab5b GTPase domain from Leishmania donovani in complex with GDP | | Authors: | Zohib, M., Pal, R.K., Biswal, B.K., Arora, A. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8xtr | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-11 |
|
