PDBID: | 8yy1 | Status: | HPUB -- hold until publication | Title: | Vo domain of V/A-ATPase from Thermus thermophilus state3 | Authors: | Nishida, Y., Kishikawa, J., Nakano, A., Yokoyama, K. | Deposition date: | 2024-04-03 |
|
PDBID: | 8yxu | Status: | HPUB -- hold until publication | Title: | Crystal structure of CsoS1A/B (modeled with CsoS1A) | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | Deposition date: | 2024-04-03 |
|
PDBID: | 8yxv | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 8yyb | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 8yya | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Concanavalin A Complexed with 5-Fluorouracil | Authors: | Rasheed, S., Arif, R. | Deposition date: | 2024-04-03 |
|
PDBID: | 8yyg | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 8yyh | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 8yyi | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 8yyj | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 8yyk | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 8yyf | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 8yy0 | Status: | HPUB -- hold until publication | Title: | Vo domain of V/A-ATPase from Thermus thermophilus state2 | Authors: | Kishikawa, J., Nishida, Y., Nakano, A., Yokoyama, K. | Deposition date: | 2024-04-03 |
|
PDBID: | 8yyd | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 8yy6 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 8yy9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 8yy7 | Status: | HPUB -- hold until publication | Title: | Crystal structure of PtmB in complex with cyclo-(L-Trp-L-Trp) and Hypoxanthine | Authors: | Zhang, Z.Y., Qu, X.D., Duan, B.R., Wei, G.Z. | Deposition date: | 2024-04-03 |
|
PDBID: | 8yye | Status: | HPUB -- hold until publication | Title: | Crystal structure of lipase CTL (Caldibacillus Thermoamylovorans) | Authors: | Pan, S.Y., Lan, D.M., Wang, Y.H. | Deposition date: | 2024-04-03 |
|
PDBID: | 9ba1 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9b9p | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 | Sequence: | >Entity 1 MTTVYYDQDVKTDALQGKKIAVVGYGSQGHAHAQNLKDNGYDVVIGIRPGRSFDKAKEDGFDVFPVAEAVKQADVIMVLLPDEIQGDVYKNEIEPNLEKHNALAFAHGFNIHFGVIQPPADVDVFLVAPKGPGHLVRRTFVEGSAVPSLFGIQQDASGQARNIALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGVSKLIQSGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGMENVRYSISNTAEFGDYVSGPRVITPDVKENMKAVLTDIQNGNFSNRFIEDNKNGFKEFYKLREEQHGHQIEKVGRELREMMPFIKSKSIEKHHHHHH
|
|
PDBID: | 9b9z | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9ba0 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9bae | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9b9u | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | SARS CoV-2 full-length spike protein with His1271Lys substitution in the coatomer binding motif, 1RBD-up conformation | Authors: | Singh, S., Hasan, S.S. | Deposition date: | 2024-04-03 |
|
PDBID: | 9b9s | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9b9q | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|