| PDBID: | 8z5o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z69 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the second bromodomain of human BRD2 BD2 in complex with the inhibitor Y13195 | | Authors: | Li, J., Hu, Q., Xu, H., Zhao, X., Zhang, C., Zhu, R., Wu, X., Zhang, Y., Xu, Y. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z62 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z6a | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SARS-CoV-2 D614G S with three ACE2 receptors binding (RB3) in prefusion conformation | | Authors: | Liu, Z., Xing, L. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z5s | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z5p | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z5m | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z54 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human SIRT5 in complex with succinylated Prx1 fragment | | Authors: | Yokoyama, T., Takayama, Y. | | Deposition date: | 2024-04-18 | | Sequence: | >Entity 1
MHHHHHHPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALA
>Entity 2
SKEYFSKQK
|
|
| PDBID: | 8z5t | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z5x | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z51 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z52 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z63 | | Status: | HPUB -- hold until publication | | Title: | alpha-L-fucosidase from Pontiella sulfatireligans F21 | | Authors: | Zhao, P., Bai, L., Wang, S. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 9f1g | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Remorin protein StREM13_150-198 | | Authors: | Xu, Z., Habenstein, B. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 9bfp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 9bfu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 9bfr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 9bgi | | Status: | HPUB -- hold until publication | | Title: | Activated wild-type SgrAI endonuclease DNA-bound dimer with Mg2+ and cleaved primary site DNA | | Authors: | Shan, Z., Lyumkis, D., Horton, N.C. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 9bgj | | Status: | HPUB -- hold until publication | | Title: | SgrAI mutant K242A endonuclease DNA-bound dimer with Mg2+ and intact primary site DNA | | Authors: | Shan, Z., Lyumkis, D., Horton, N.C. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 9bgb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 9bg7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Tri-complex of Compound-6, KRAS G12V, and CypA | | Authors: | Tomlinson, A.C.A., Saldajeno-Concar, M., Knox, J.E., Yano, J.K. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 9bg2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Tri-complex of Compound-11, KRAS G12V, and CypA | | Authors: | Tomlinson, A.C.A., Bieder, R., Chen, A., Knox, J.E., Yano, J.K. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 9bgc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 9bgg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 9bfz | | Status: | HPUB -- hold until publication | | Title: | Tri-complex of Compound-5, KRAS G12C, and CypA | | Authors: | Tomlinson, A.C.A., Saldajeno-Concar, M., Knox, J.E., Yano, J.K. | | Deposition date: | 2024-04-18 |
|
