| PDBID: | 9eyu | | Status: | HPUB -- hold until publication | | Title: | Human PRMT5 in complex with AZ compound 1 | | Authors: | Debreczeni, J. | | Deposition date: | 2024-04-09 |
|
| PDBID: | 9eyv | | Status: | HPUB -- hold until publication | | Title: | Human PRMT5 in complex with AZ compound 12 | | Authors: | Debreczeni, J. | | Deposition date: | 2024-04-09 |
|
| PDBID: | 9eyw | | Status: | HPUB -- hold until publication | | Title: | Human PRMT5 in complex with AZ compound 21 | | Authors: | Debreczeni, J. | | Deposition date: | 2024-04-09 |
|
| PDBID: | 8x7e | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-24 |
|
| PDBID: | 9eyx | | Status: | HPUB -- hold until publication | | Title: | Human PRMT5 in complex with AZ compound 28 | | Authors: | Debreczeni, J. | | Deposition date: | 2024-04-09 |
|
| PDBID: | 8x7i | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-24 |
|
| PDBID: | 9ery | | Status: | HPUB -- hold until publication | | Title: | Co-crystal strucutre of PD-L1 with low molecular weight inhibitor | | Authors: | Plewka, J., Magiera-Mularz, K., Zhang, W. | | Deposition date: | 2024-03-25 |
|
| PDBID: | 8x7j | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-24 |
|
| PDBID: | 8x7k | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-24 |
|
| PDBID: | 9ez0 | | Status: | HPUB -- hold until publication | | Title: | Poliovirus type 1 (strain Mahoney) expanded conformation stabilised virus-like particle (PV1 SC6b) from a yeast expression system. | | Authors: | Bahar, M.W., Sherry, L., Stonehouse, N.J., Rowlands, D.J., Fry, E.E., Stuart, D.I. | | Deposition date: | 2024-04-10 |
|
| PDBID: | 9ez4 | | Status: | HPUB -- hold until publication | | Title: | Complex of a mutant of the SARS-CoV-2 main protease Mpro with the nsp5/6 substrate peptide. | | Authors: | Battistutta, R., Fornasier, E., Giachin, G. | | Deposition date: | 2024-04-10 |
|
| PDBID: | 8x7o | | Status: | HPUB -- hold until publication | | Title: | PiB-bound E46K mutanted alpha-synuclein fibrils | | Authors: | Liu, K.E., Tao, Y.Q., Li, D., Liu, C. | | Deposition date: | 2023-11-24 |
|
| PDBID: | 9ez5 | | Status: | HPUB -- hold until publication | | Title: | BsmI (Inactive) crystallized with Mg2+ and cognate dsDNA | | Authors: | Sieskind, R., Missoury, S., Madru, C., Commenge, I., Niogret, G., Rondelez, Y., Haouz, A., Legrand, P., Sauguet, L., Delarue, M. | | Deposition date: | 2024-04-10 |
|
| PDBID: | 8x7m | | Status: | HPUB -- hold until publication | | Title: | CR-bound E46K alpha-synuclein fibrils | | Authors: | Liu, K.E., Tao, Y.Q., Li, D., Liu, C. | | Deposition date: | 2023-11-24 |
|
| PDBID: | 9ez6 | | Status: | HPUB -- hold until publication | | Title: | Complex of a mutant of the SARS-CoV-2 main protease Mpro with the nsp14/15 substrate peptide. | | Authors: | Battistutta, R., Fornasier, E., Giachin, G. | | Deposition date: | 2024-04-10 |
|
| PDBID: | 9et9 | | Status: | HPUB -- hold until publication | | Title: | CDK2-cyclin A in complex with FragLite 4 | | Authors: | Hope, I., Martin, M.P., Waring, M.J., Noble, M.E.M., Endicott, J.A., Tatum, N.J. | | Deposition date: | 2024-03-26 | | Sequence: | >Entity 1
GVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNSKYHGVSLLNPPETLNVHHHHHH
>Entity 2
GPGSMENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTY(TPO)HEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
|
|
| PDBID: | 9et8 | | Status: | HPUB -- hold until publication | | Title: | CDK2-cyclin A in complex with FragLite 5 | | Authors: | Hope, I., Martin, M.P., Waring, M.J., Noble, M.E.M., Endicott, J.A., Tatum, N.J. | | Deposition date: | 2024-03-26 | | Sequence: | >Entity 1
GVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNSKYHGVSLLNPPETLNVHHHHHH
>Entity 2
GPGSMENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTY(TPO)HEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
|
|
| PDBID: | 8x7l | | Status: | HPUB -- hold until publication | | Title: | EB-bound E46K alpha-synuclein fibrils | | Authors: | Liu, K.E., Tao, Y.Q., Li, D., Liu, C. | | Deposition date: | 2023-11-24 |
|
| PDBID: | 9et7 | | Status: | HPUB -- hold until publication | | Title: | CDK2-cyclin A in complex with FragLite 6 | | Authors: | Hope, I., Martin, M.P., Waring, M.J., Noble, M.E.M., Endicott, J.A., Tatum, N.J. | | Deposition date: | 2024-03-26 | | Sequence: | >Entity 1
GPGSMENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTY(TPO)HEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
>Entity 2
GVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNSKYHGVSLLNPPETLNVHHHHHH
|
|
| PDBID: | 8x7p | | Status: | HPUB -- hold until publication | | Title: | CCA-bound E46K alpha-synuclein fibrils | | Authors: | Liu, K.E., Tao, Y.Q., Li, D., Liu, C. | | Deposition date: | 2023-11-24 |
|
| PDBID: | 8x7q | | Status: | HPUB -- hold until publication | | Title: | pFTAA-bound E46K alpha-synuclein fibrils | | Authors: | Liu, K.E., Tao, Y.Q., Li, D., Liu, C. | | Deposition date: | 2023-11-24 |
|
| PDBID: | 9etn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8x89 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Streptococcus pneumoniae fabG | | Authors: | Xu, K.M. | | Deposition date: | 2023-11-27 | | Sequence: | >Entity 1
MKLEHKNIFITGSSRGIGLAIAHKFAQAGANIVLNSRGAISEELLAEFSNYGIKVVPISGDVSDFADAKRMIDQAIAELGSVDVLVNNAGITQDTLMLKMTEADFEKVLKVNLTGAFNMTQSVLKPMMKAREGAIINMSSVVGLMGNIGQANYAASKAGLIGFTKSVAREVASRNIRVNVIAPGMIESDMTAILSDKIKEATLAQIPMKEFGQAEQVADLTVFLAGQDYLTGQVIAIDGGLSM
|
|
| PDBID: | 9ez9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8x8m | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
