| PDBID: | 9cut | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-26 |
|
| PDBID: | 8xxe | | Status: | HPUB -- hold until publication | | Title: | TtCS-intermediate complex | | Authors: | Yang, L., Fang, Y.J. | | Deposition date: | 2024-01-18 |
|
| PDBID: | 8xxc | | Status: | HPUB -- hold until publication | | Title: | DaCS-intermediate complex | | Authors: | Yang, L., Fang, Y.J. | | Deposition date: | 2024-01-18 |
|
| PDBID: | 8xxf | | Status: | HPUB -- hold until publication | | Title: | TtCS, oxaloacetate, acetyl-CoA complex | | Authors: | Yang, L., Fang, Y.J. | | Deposition date: | 2024-01-18 |
|
| PDBID: | 8gm8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-03-24 | | Release date: | 2024-09-19 |
|
| PDBID: | 8gma | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-03-24 | | Release date: | 2024-09-25 |
|
| PDBID: | 8xxk | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human 8-oxoguanine glycosylase K249H mutant bound to the reaction intermediate derived from the crystal soaked into the solution at pH 4.0 under 298 K for 3 weeks | | Authors: | Unno, M., Koga, M., Miniwa, N., Komuro, S., Tanaka, Y. | | Deposition date: | 2024-01-18 |
|
| PDBID: | 8xxg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-18 |
|
| PDBID: | 8xxh | | Status: | HPUB -- hold until publication | | Title: | Structure of CXCR2 bound to CXCL2 (CXCR2-CXCL2-Go Full map) | | Authors: | Sano, F.K., Saha, S., Sharma, S., Ganguly, M., Shihoya, W., Nureki, O., Shukla, A.K., Banerjee, R. | | Deposition date: | 2024-01-18 |
|
| PDBID: | 8xxp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-18 |
|
| PDBID: | 9cu8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-26 |
|
| PDBID: | 8xxr | | Status: | HPUB -- hold until publication | | Title: | Structure of CXCR2 bound to CXCL6 (CXCR2-CXCL6-Go Full map) | | Authors: | Sano, F.K., Saha, S., Sharma, S., Ganguly, M., Shihoya, W., Nureki, O., Shukla, A.K., Banerjee, R. | | Deposition date: | 2024-01-18 |
|
| PDBID: | 9cug | | Status: | HPUB -- hold until publication | | Title: | X-ray Structure of human Interferon Regulatory Factor 4 (IRF4) IAD Domain | | Authors: | Seo, H.-S., Agius, M.P., Dhe-Paganon, S. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 8gmj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-03-26 | | Release date: | 2024-10-31 |
|
| PDBID: | 8xy5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-19 |
|
| PDBID: | 8xy1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-19 |
|
| PDBID: | 8xy2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-19 |
|
| PDBID: | 8xy3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-19 |
|
| PDBID: | 8xxu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-19 |
|
| PDBID: | 8ixn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-04-01 | | Release date: | 2024-10-01 |
|
| PDBID: | 8xy6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-19 |
|
| PDBID: | 8xyc | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of dVemCas12e-sgRNA-dsDNA | | Authors: | Zhang, S., Lin, S., Liu, J.J.G. | | Deposition date: | 2024-01-19 |
|
| PDBID: | 9etc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of recombinant chicken liver Bile Acid Binding Protein (cL-BABP) in complex with chenodeoxycholic acid | | Authors: | Tassone, G., Pozzi, C. | | Deposition date: | 2024-03-26 | | Sequence: | >Entity 1
GSHMAFSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQEVKGNEMVETITFGGVTLIRRSKRV
|
|
| PDBID: | 8xyk | | Status: | HPUB -- hold until publication | | Title: | Structure of CXCR3 in complex with VUF10661 and Go (Full map) | | Authors: | Sano, F.K., Saha, S., Sharma, S., Ganguly, M., Shihoya, W., Nureki, O., Shukla, A.K., Banerjee, R. | | Deposition date: | 2024-01-19 |
|
| PDBID: | 8xyv | | Status: | HPUB -- hold until publication | | Title: | De novo designed protein 0705-5 | | Authors: | Liu, J.L., Guo, Z., Lai, L.H. | | Deposition date: | 2024-01-20 |
|
