PDBID: | 9f46 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-26 |
|
PDBID: | 9f3u | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-26 |
|
PDBID: | 9f47 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-26 |
|
PDBID: | 8y13 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-23 |
|
PDBID: | 8y25 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-25 |
|
PDBID: | 8phm | Status: | HPUB -- hold until publication | Title: | Oxalate-bound cobalt(II) human carbonic anhydrase II | Authors: | Gigli, L., Malanho Silva, J., Cerofolini, L., Macedo, A.L., Geraldes, C.F.G.C., Suturina, E.A., Calderone, V., Fragai, M., Parigi, G., Ravera, E., Luchinat, C. | Deposition date: | 2023-06-20 | Release date: | 2024-12-20 | Sequence: | >Entity 1 NWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
PDBID: | 8y29 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-25 |
|
PDBID: | 9f5h | Status: | HPUB -- hold until publication | Title: | Crystal structure of MGAT5 bump-and-hole mutant in complex with UDP and M592 | Authors: | Liu, Y., Bineva-Todd, G., Meek, R., Mazo, L., Piniello, B., Moroz, O.V., Begum, N., Roustan, C., Tomita, S., Kjaer, S., Rovira, C., Davies, G.J., Schumann, B. | Deposition date: | 2024-04-28 |
|
PDBID: | 9f56 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-28 |
|
PDBID: | 8y2a | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-25 |
|
PDBID: | 9f57 | Status: | HPUB -- hold until publication | Title: | Identification of chloride ions in lysozyme. | Authors: | Duman, R., El Omari, K., Forsyth, I., Wagner, A. | Deposition date: | 2024-04-28 |
|
PDBID: | 8y2b | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-25 |
|
PDBID: | 8y26 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-25 |
|
PDBID: | 9f5a | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-28 |
|
PDBID: | 8y28 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-25 |
|
PDBID: | 8jti | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-21 | Release date: | 2024-12-21 |
|
PDBID: | 9f5b | Status: | HPUB -- hold until publication | Title: | Identification of zinc ions in LMO4. | Authors: | El Omari, K., Forsyth, I., Mancini, E.J., Wagner, A. | Deposition date: | 2024-04-28 |
|
PDBID: | 8y1o | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-25 |
|
PDBID: | 9f5i | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-28 |
|
PDBID: | 8y1p | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-25 |
|
PDBID: | 9f5n | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-29 |
|
PDBID: | 8y1k | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-25 |
|
PDBID: | 9f5s | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-30 |
|
PDBID: | 8y1y | Status: | HPUB -- hold until publication | Title: | Crystal structure of the Mcl-1 in complex with a long BH3 peptide of BAK | Authors: | Wang, H., Guo, M., Wei, H., Chen, Y. | Deposition date: | 2024-01-25 |
|
PDBID: | 9f6a | Status: | HPUB -- hold until publication | Title: | EVA71 E096A native particle | Authors: | Kingston, N.J., Stonehouse, N.J., Rowlands, D.J., Hogle, J.M., Filman, D.J., Snowden, J.S.S. | Deposition date: | 2024-04-30 |
|