| PDBID: | 8w3n | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of prefusion-stabilized RSV F protein UFCR3 | | Authors: | Lee, Y.Z., Stanfield, R.L., Wilson, I.A., Zhu, J. | | Deposition date: | 2024-02-22 |
|
| PDBID: | 8w3o | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of prefusion-stabilized RSV F protein UFCR3-GDQ | | Authors: | Lee, Y.Z., Stanfield, R.L., Wilson, I.A., Zhu, J. | | Deposition date: | 2024-02-22 |
|
| PDBID: | 9erd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8w3p | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of prefusion-stabilized RSV F protein UFCR3-D(1TD0) | | Authors: | Lee, Y.Z., Stanfield, R.L., Wilson, I.A., Zhu, J. | | Deposition date: | 2024-02-22 |
|
| PDBID: | 9ere | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8w3q | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of prefusion-stabilized hMPV F protein UFCM1-P2-iSS | | Authors: | Lee, Y.Z., Stanfield, R.L., Wilson, I.A., Zhu, J. | | Deposition date: | 2024-02-22 |
|
| PDBID: | 8g4k | | Status: | HPUB -- hold until publication | | Title: | Complex of TbRII mini protein binder bound to the TbRII ECD | | Authors: | Schwartze, T.S., Hinck, A.P. | | Deposition date: | 2023-02-09 | | Release date: | 2024-08-14 |
|
| PDBID: | 9erf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8w3r | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of prefusion-stabilized RSV F protein UFCR2-iSS-P2-NQ in complex with A4 single-chain fragment variable | | Authors: | Lee, Y.Z., Stanfield, R.L., Wilson, I.A., Zhu, J. | | Deposition date: | 2024-02-22 |
|
| PDBID: | 8w40 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-22 |
|
| PDBID: | 9eqn | | Status: | HPUB -- hold until publication | | Title: | N-terminal domain of Infectious Bursal Disease Virus (IBDV) VP3 | | Authors: | Ferrero, D.S., Verdaguer, N. | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8w3z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-22 |
|
| PDBID: | 9eqo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8w3y | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a computationally designed metalloprotein containing the metal-chelating, fluorogenic, non-canonical amino acid 3-(8-hydroxyquinolin-3-yl)-L-alanine: apo form | | Authors: | Kelly, P.I., Henderson, J.N., Mills, J.H. | | Deposition date: | 2024-02-22 |
|
| PDBID: | 9eqp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8w38 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-22 |
|
| PDBID: | 9eqr | | Status: | HPUB -- hold until publication | | Title: | 8fs pulse duration 50uJ pulse energy thaumatin | | Authors: | Owen, R.L., Hough, M.A., Worrall, J., Williams, L. | | Deposition date: | 2024-03-22 | | Sequence: | >Entity 1
ATFEIVNRCSYTVWAAASKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSGSGICKTGDCGGLLRCKRFGRPPTTLAEFSLNQYGKDYIDISNIKGFNVPMDFSPTTRGCRGVRCAADIVGQCPAKLKAPGGGCNDACTVFQTSEYCCTTGKCGPTEYSRFFKRLCPDAFSYVLDKPTTVTCPGSSNYRVTFCPTA
|
|
| PDBID: | 8w3b | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-22 |
|
| PDBID: | 8g80 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of full length Neuroligin-2 from Mouse bound to two Neurexin-1 Beta conformation two | | Authors: | Boyd, R., Wang, W. | | Deposition date: | 2023-02-17 | | Release date: | 2024-08-01 |
|
| PDBID: | 9eqt | | Status: | HPUB -- hold until publication | | Title: | 24fs pulse duration 10uJ pulse energy thaumatin | | Authors: | Owen, R.L., Hough, M.A., Worrall, J., Williams, L. | | Deposition date: | 2024-03-22 | | Sequence: | >Entity 1
ATFEIVNRCSYTVWAAASKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSGSGICKTGDCGGLLRCKRFGRPPTTLAEFSLNQYGKDYIDISNIKGFNVPMDFSPTTRGCRGVRCAADIVGQCPAKLKAPGGGCNDACTVFQTSEYCCTTGKCGPTEYSRFFKRLCPDAFSYVLDKPTTVTCPGSSNYRVTFCPTA
|
|
| PDBID: | 8w3d | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-22 |
|
| PDBID: | 9eqx | | Status: | HPUB -- hold until publication | | Title: | 41fs pulse duration 50uJ pulse energy thaumatin | | Authors: | Owen, R.L., Hough, M.A., Worrall, J., Williams, L. | | Deposition date: | 2024-03-22 | | Sequence: | >Entity 1
ATFEIVNRCSYTVWAAASKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSGSGICKTGDCGGLLRCKRFGRPPTTLAEFSLNQYGKDYIDISNIKGFNVPMDFSPTTRGCRGVRCAADIVGQCPAKLKAPGGGCNDACTVFQTSEYCCTTGKCGPTEYSRFFKRLCPDAFSYVLDKPTTVTCPGSSNYRVTFCPTA
|
|
| PDBID: | 8w37 | | Status: | HPUB -- hold until publication | | Title: | Structure and interactions of HIV-1 gp41 CHR-NHR reverse hairpin constructs reveal molecular determinants of antiviral activity | | Authors: | McAndrew, R.P., Ralston, C.Y., Gochin, M. | | Deposition date: | 2024-02-22 |
|
| PDBID: | 9eqy | | Status: | HPUB -- hold until publication | | Title: | 41fs pulse duration 100uJ pulse energy thaumatin | | Authors: | Owen, R.L., Hough, M.A., Worrall, J., Williams, L. | | Deposition date: | 2024-03-22 | | Sequence: | >Entity 1
ATFEIVNRCSYTVWAAASKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSGSGICKTGDCGGLLRCKRFGRPPTTLAEFSLNQYGKDYIDISNIKGFNVPMDFSPTTRGCRGVRCAADIVGQCPAKLKAPGGGCNDACTVFQTSEYCCTTGKCGPTEYSRFFKRLCPDAFSYVLDKPTTVTCPGSSNYRVTFCPTA
|
|
| PDBID: | 8w3u | | Status: | HPUB -- hold until publication | | Title: | Structure of Epimerase Mth373 from the thermophilic pseudomurein-containing methanogen Methanothermobacter thermautotrophicus | | Authors: | Carbone, V., Schofield, L.R., Sutherland-Smith, A.J., Ronimus, R.S. | | Deposition date: | 2024-02-22 |
|
