PDBID: | 8wwg | Status: | HPUB -- hold until publication | Title: | The crystal structure of Legionella pneumophila adenosylhomocysteinase Lpg2021 complex with NAD | Authors: | Gao, Y.S., Xie, R., Chen, Y.N. | Deposition date: | 2023-10-25 |
|
PDBID: | 9cxc | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-31 |
|
PDBID: | 8wx6 | Status: | HPUB -- hold until publication | Title: | X-Ray crystal structure of glycoside hydrolase family 6 cellobiohydrolase from Phanerochaete chrysosporium PcCel6A C240S/C393S | Authors: | Yamaguchi, S., Sunagawa, N., Tachioka, M., Igarashi, K. | Deposition date: | 2023-10-27 |
|
PDBID: | 9cxd | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-31 |
|
PDBID: | 8wx9 | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-27 |
|
PDBID: | 8wwz | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-27 |
|
PDBID: | 8wxc | Status: | HPUB -- hold until publication | Title: | X-Ray crystal structure of glycoside hydrolase family 6 cellobiohydrolase from Phanerochaete chrysosporium PcCel6A D170N/C240S/C393S | Authors: | Yamaguchi, S., Sunagawa, N., Tachioka, M., Igarashi, K. | Deposition date: | 2023-10-28 |
|
PDBID: | 8wzo | Status: | HPUB -- hold until publication | Title: | Parkin in complex with phospho NEDD8 | Authors: | Lenka, D.R., Kumar, A. | Deposition date: | 2023-11-02 |
|
PDBID: | 8wzn | Status: | HPUB -- hold until publication | Title: | ParkinK211N in complex with phospho NEDD8 | Authors: | Lenka, D.R., Kumar, A. | Deposition date: | 2023-11-02 |
|
PDBID: | 8wzs | Status: | HPUB -- hold until publication | Title: | Crystal structure of SRCRD11 of human DMBT1 from needle-shape crystal | Authors: | Zhang, C., Lu, P., Nagata, K. | Deposition date: | 2023-11-02 | Sequence: | >Entity 1 TAGSESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSASQSQPTPS
|
|
PDBID: | 9cxm | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-31 |
|
PDBID: | 9cxn | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-31 |
|
PDBID: | 8x86 | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-27 |
|
PDBID: | 9cxo | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-31 |
|
PDBID: | 8x8a | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-27 |
|
PDBID: | 8wzw | Status: | HPUB -- hold until publication | Title: | X-Ray crystal structure of glycoside hydrolase family 6 cellobiohydrolase from Phanerochaete chrysosporium PcCel6A C240S/C393S/D394N | Authors: | Yamaguchi, S., Sunagawa, N., Tachioka, M., Igarashi, K. | Deposition date: | 2023-11-02 |
|
PDBID: | 8wy2 | Status: | HPUB -- hold until publication | Title: | X-Ray crystal structure of glycoside hydrolase family 6 cellobiohydrolase from Phanerochaete chrysosporium PcCel6A S176V/C240S/C393S | Authors: | Yamaguchi, S., Sunagawa, N., Tachioka, M., Igarashi, K. | Deposition date: | 2023-10-30 |
|
PDBID: | 8x92 | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-29 |
|
PDBID: | 8wz5 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of prefusion-stabilized RSV F (DS-Cav1 sc9-10 strain: B18537) in complex with humanized nAb 5B11 | Authors: | Liu, L., Sun, H., Sun, Y., Zheng, Q., Li, S., Zheng, Z., Xia, N. | Deposition date: | 2023-11-01 |
|
PDBID: | 8wz6 | Status: | HPUB -- hold until publication | Title: | The crystal structure of Legionella pneumophila adenosylhomocysteinase Lpg2021 in ternary complex with NAD and DZNep | Authors: | Gao, Y.S., Xie, R., Chen, Y.N., Ma, J.M., Ge, H.H. | Deposition date: | 2023-11-01 |
|
PDBID: | 8x0a | Status: | HPUB -- hold until publication | Title: | Crystal Structure of MftR from mycobacterium tuberculosis | Authors: | Peng, F., Ke, Z.H., Li, Y. | Deposition date: | 2023-11-04 |
|
PDBID: | 8wz7 | Status: | HPUB -- hold until publication | Title: | The crystal structure of Legionella pneumophila adenosylhomocysteinase Lpg2021(I255A,T287A) in ternary complex with NAD and adenosine | Authors: | Gao, Y.S., Xie, R., Chen, Y.N., Ma, J.M., Ge, H.H. | Deposition date: | 2023-11-01 |
|
PDBID: | 8wzc | Status: | HPUB -- hold until publication | Title: | NYN domain of human KHNYN complex with RNA | Authors: | Hong, S., Choe, J. | Deposition date: | 2023-11-01 |
|
PDBID: | 9cxw | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-31 |
|
PDBID: | 8wz8 | Status: | HPUB -- hold until publication | Title: | The crystal structure of Legionella pneumophila adenosylhomocysteinase Lpg2021(T67A,Q69A) complex with NAD | Authors: | Gao, Y.S., Xie, R., Chen, Y.N., Ma, J.M., Ge, H.H. | Deposition date: | 2023-11-01 |
|