| PDBID: | 8gdq | | Status: | HPUB -- hold until publication | | Title: | BMP-9 Monomer Growth Factor with Cysteinylation | | Authors: | Schwartze, T.A., Hinck, A.P. | | Deposition date: | 2023-03-06 | | Release date: | 2024-09-11 |
|
| PDBID: | 9bct | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-09 |
|
| PDBID: | 8vte | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-26 |
|
| PDBID: | 9be5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-14 |
|
| PDBID: | 8ghl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-03-10 | | Release date: | 2024-09-11 |
|
| PDBID: | 8vtg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-26 |
|
| PDBID: | 9be6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-14 |
|
| PDBID: | 8vth | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-26 |
|
| PDBID: | 9b0c | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-11 |
|
| PDBID: | 8vt8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-26 |
|
| PDBID: | 9bg3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8vtf | | Status: | HPUB -- hold until publication | | Title: | A structural study of selectivity mechanisms for JNK3 and p38 alpha with indazole scaffold probing compounds | | Authors: | Park, H., Feng, Y. | | Deposition date: | 2024-01-26 |
|
| PDBID: | 8vti | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-26 |
|
| PDBID: | 9b0t | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of E227Q variant of uMtCK1 in complex with transition state analog | | Authors: | Demir, M., Koepping, L., Zhao, J., Sergienko, E. | | Deposition date: | 2024-03-12 |
|
| PDBID: | 8vtq | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of human Tryptophan 2,3-dioxygenase in complex with PPN3 inhibitor | | Authors: | Geeraerts, Z., Yeh, S.-R. | | Deposition date: | 2024-01-26 |
|
| PDBID: | 9b0u | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of E227Q variant of uMtCK1 incubated with ADP and phosphocreatine at pH 8.0 | | Authors: | Demir, M., Koepping, L., Zhao, J., Sergienko, E. | | Deposition date: | 2024-03-12 |
|
| PDBID: | 8vu0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-27 |
|
| PDBID: | 9b0e | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-12 |
|
| PDBID: | 8vtz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-27 |
|
| PDBID: | 9b0n | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-12 |
|
| PDBID: | 8vu1 | | Status: | HPUB -- hold until publication | | Title: | Structure of FabS1CE3-EPR-1, an elbow-locked high affinity antibody for the erythropoeitin receptor (trigonal form) | | Authors: | Singer, A.U., Bruce, H.A., Pavlenco, A., Ploder, L., Luu, G., Blazer, L., Adams, J.J., Sidhu, S.S. | | Deposition date: | 2024-01-27 | | Sequence: | >Entity 1
EVQLVESGGGLVQPGGSLRLSCAASGFNLRSYYMHWVRQAPGKGLEWVASISPYYSYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARHGYGAMDYWGQGTLVTVFNQIKGPSVFPLAPSSKSTSGGTAALGCLVKDYWPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT
>Entity 2
DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQSSYSLITFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVSWYVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTQGTTSVTKSFNRGEC
|
|
| PDBID: | 9b0o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-12 |
|
| PDBID: | 8vtu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with macrolone MCX-66, mRNA, aminoacylated A-site Phe-tRNAphe, aminoacylated P-site fMet-tRNAmet, and deacylated E-site tRNAphe at 2.40A resolution | | Authors: | Aleksandrova, E.V., Ma, C.-X., Klepacki, D., Alizadeh, F., Vazquez-Laslop, N., Liang, J.-H., Polikanov, Y.S., Mankin, A.S. | | Deposition date: | 2024-01-27 |
|
| PDBID: | 9b7b | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9bhc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
