| PDBID: | 9iwz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the mouse RIP3 kinase domain in complexed with GSK''843 | | Authors: | Xie, H., Su, H.X., Li, M.J., Xu, Y.C. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the mouse RIP3 kinase domain in complexed with GW''39B | | Authors: | Xie, H., Su, H.X., Li, M.J., Xu, Y.C. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the mouse RIP3 kinase domain in complexed with PP2 | | Authors: | Xie, H., Su, H.X., Li, M.J., Xu, Y.C. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the mouse RIP3 kinase domain in complexed with TAK-632 | | Authors: | Xie, H., Su, H.X., Li, M.J., Xu, Y.C. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the mouse RIP3 kinase domain in complexed with compound 18 | | Authors: | Xie, H., Su, H.X., Li, M.J., Xu, Y.C. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix9 | | Status: | PROC -- to be processed | | Title: | Mutant H286T Crystal Structure of Two-domain bacterial laccase from the actinobacterium Streptomyces carpinensis VKM Ac-1300 | | Authors: | Gabdulkhakov, A.G., Tishchenko, T.V., Trubitsina, L., Trubitsin, I., Leontievsky, A., Lisov, A. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix8 | | Status: | HPUB -- hold until publication | | Title: | Crystallization and structural characterization of phosphopentomutase from the hyperthermophilic archaeon Thermococcus kodakarensis | | Authors: | Naz, Z., Lubkowski, T.J., Saleem, M., Rahman, M., Wlodawer, A., Rashid, N. | | Deposition date: | 2024-07-26 | | Sequence: | >Entity 1
RLFGTAGIRGTLWEKVTPELAMKVGMAVGTYKSGKALVGRDGRTSSVMLKNAMISGLLSTGMEVLDADLIPTPALAWGTRKLADAGVMITASHNPPTDNGVKVFNGDGTEFYVEQERGLEEIIFSGNFRKARWDEIKPVRNVEVIPDYINAVLDFVGHETNLKVLYDGANGAGSLVAPYLLREMGAKVLSVNAHVDGHFPGRKPEPRYENIAYLGKLVRELGVDLAIAQDGDADRIAVFDEKGNYVDEDTVIALFAKLYVEEHGGGTVVVSIDTGSRIDAVVERAGGRVVRIPLGQPHDGIKRYKAIFAAEPWKLVHPKFGPWIDPFVTMGLLIKLIDENGPLSELVKEIPTYYLKKANVLCPDEYKAEVVRRAAEEVERKLSSEIKEVLTISGFRIALNDGSWILIRPSGTEPKIRVVAEAPTEKRRDELFEMAYSTVSRIVKEAEKK
|
|
| PDBID: | 9iwv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Lsd18 after incubation with the substrate | | Authors: | Wang, Q., Chen, X., Kim, C.Y. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix4 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | An agonist(compound 15n) of Thyroid Hormone Receptor B | | Authors: | Benqiang, Y., Yong, L. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9iwu | | Status: | HPUB -- hold until publication | | Title: | CTB10_M40BpA_M86I-R-1d | | Authors: | Fu, K., Rao, Y.J. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9iwt | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Cas12X2 with crRNA | | Authors: | Xi, Z. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of homolog of dihydroxyacid dehydratase(AstD) from Aspergillus terreus | | Authors: | Huang, W.X., Zhang, P.X., Zhou, J.H. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ixa | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of chikungunya virus glycoprotein E1-E2 with C34 Fab. | | Authors: | Han, X., Ji, C., Wang, F., Tian, S., Gao, F.G., Yan, J. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ctj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9ctp | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9ctn | | Status: | PROC -- to be processed | | Title: | Modifying region of EcPKS2 - acetylated dataset | | Authors: | Schubert, H.L., Hill, C.P., Li, F., Schmidt, E.W. | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9cu3 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9ctf | | Status: | PROC -- to be processed | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9ctg | | Status: | PROC -- to be processed | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9cti | | Status: | PROC -- to be processed | | Title: | Condensing region of EcPKS2 - malonylCoA inhibited dataset | | Authors: | Schubert, H.L., Hill, C.P. | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9ctk | | Status: | PROC -- to be processed | | Title: | Modifying region of EcPKS2 - malonylCoA inhibited dataset | | Authors: | Schubert, H.L., Hill, C.P. | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9ctl | | Status: | PROC -- to be processed | | Title: | Full length EcPKS2 - malonylCoA inhibited dataset | | Authors: | Schubert, H.L., Hill, C.P. | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9ctq | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-25 |
|
