| PDBID: | 7iat | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Zika NS2B-NS3 protease in complex with fragment EOS102811 from ECBL-96 | | Authors: | Benz, L.S., Wollenhaupt, J., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S. | | Deposition date: | 2025-05-21 |
|
| PDBID: | 9ltg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of H-2Kb with C.parvum peptide | | Authors: | Fan, S.H., Wang, Y.L. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 7iau | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Zika NS2B-NS3 protease in complex with fragment EOS102654 from ECBL-96 | | Authors: | Benz, L.S., Wollenhaupt, J., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S. | | Deposition date: | 2025-05-21 |
|
| PDBID: | 9lt7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9rae | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-20 |
|
| PDBID: | 7iav | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Zika NS2B-NS3 protease in complex with fragment EOS102592 from ECBL-96 | | Authors: | Benz, L.S., Wollenhaupt, J., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S. | | Deposition date: | 2025-05-21 |
|
| PDBID: | 9ltf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of mSTING-TTB | | Authors: | Zhang, C.G., Hou, Y.F., Liu, P.Y., Fan, S.L. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9rah | | Status: | HPUB -- hold until publication | | Title: | PhiC31 integrase on attL | | Authors: | Spagnolo, L., Sun, Y.E., Joseph, A.P. | | Deposition date: | 2025-05-20 |
|
| PDBID: | 9r0v | | Status: | HPUB -- hold until publication | | Title: | CutC IN COMPLEX WITH Inhibitor | | Authors: | Petersen, J. | | Deposition date: | 2025-04-24 |
|
| PDBID: | 7iaw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Zika NS2B-NS3 protease in complex with fragment EOS102818 from ECBL-96 | | Authors: | Benz, L.S., Wollenhaupt, J., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S. | | Deposition date: | 2025-05-21 |
|
| PDBID: | 9ltd | | Status: | HPUB -- hold until publication | | Title: | Human PKM2 complex with serine | | Authors: | Wang, J., Wu, C. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 7iax | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Zika NS2B-NS3 protease in complex with fragment EOS103099 from ECBL-96 | | Authors: | Benz, L.S., Wollenhaupt, J., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S. | | Deposition date: | 2025-05-21 |
|
| PDBID: | 9lte | | Status: | HPUB -- hold until publication | | Title: | Human PKM2 complex with methionine | | Authors: | Wang, J., Wu, C. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9r10 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-24 |
|
| PDBID: | 9rb5 | | Status: | HPUB -- hold until publication | | Title: | Staphylokinase SY155 | | Authors: | Legrand, A., Kaderavek, P., Zidek, L., Marek, M., Prokop, Z., Damborsky, J. | | Deposition date: | 2025-05-21 |
|
| PDBID: | 7iay | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Zika NS2B-NS3 protease in complex with fragment EOS103107 from ECBL-96 | | Authors: | Benz, L.S., Wollenhaupt, J., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S. | | Deposition date: | 2025-05-21 |
|
| PDBID: | 9ltq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human RAB43 in complex with GppNHp | | Authors: | Wang, J., Yan, W.P. | | Deposition date: | 2025-02-06 | | Sequence: | >Entity 1
GGDPDEQYDFLFKLVLVGDASVGKTCVVQRFKTGAFSERQGSTIGVDFTMKTLEIQGKRVKLQIWDTAGQERFRTITQSYYRSANGAILAYDITKRSSFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLSELREVSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGGPLFS
|
|
| PDBID: | 9exl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-08 | | Release date: | 2025-10-08 |
|
| PDBID: | 7iaz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Zika NS2B-NS3 protease in complex with fragment EOS103092 from ECBL-96 | | Authors: | Benz, L.S., Wollenhaupt, J., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S. | | Deposition date: | 2025-05-21 |
|
| PDBID: | 9ltj | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9fbb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 | | Release date: | 2025-11-13 |
|
| PDBID: | 9raj | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-21 |
|
| PDBID: | 7ib0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Zika NS2B-NS3 protease in complex with fragment EOS102853 from ECBL-96 | | Authors: | Benz, L.S., Wollenhaupt, J., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S. | | Deposition date: | 2025-05-21 |
|
| PDBID: | 9lts | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9fbe | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | 3-keto-glycoside eliminase/hydratase in komplex with 2-hydroxy-3-keto-glucal | | Authors: | Pfeiffer, M., Kastner, K., Oberdorfer, G., Nidetzky, B. | | Deposition date: | 2024-05-13 |
|
