| PDBID: | 9eg3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9efa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9eg1 | | Status: | HPUB -- hold until publication | | Title: | COP9 signalosome deneddylation complex with cullin-5 | | Authors: | Shi, H., Zheng, N. | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9eft | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9efd | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure in space group C2221 of a nucleoid-associated protein (UBP) from Sulfolobus islandicus. | | Authors: | Dhanaraju, R., Gonzalez-Gutierrez, G., Bell, S.D. | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9efi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9efg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9eff | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of a nucleoid-associated protein (UBP) bound to DNA from Sulfolobus islandicus. | | Authors: | Dhanaraju, R., Gonzalez-Gutierrez, G., Bell, S.D. | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9efh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9efn | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of Saccharomyces cerevisiae cross-linked Sfh1 (K197C, F233C) mutant in complex with phosphatidylethanolamine | | Authors: | Green, S.M., Laganowsky, A., Krieger, I., Singh, P.K., Igumenova, T.I., Bankaitis, V.A., Sacchettini, J. | | Deposition date: | 2024-11-20 | | Release date: | 2025-11-20 |
|
| PDBID: | 9efb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9efs | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9efe | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure in space group P21 of a nucleoid-associated protein (UBP) from Sulfolobus islandicus. | | Authors: | Dhanaraju, R., Gonzalez-Gutierrez, G., Bell, S.D. | | Deposition date: | 2024-11-20 | | Sequence: | >Entity 1
HMIVMRVKVNEKQFDMIIDKLKLMVYEYNTKIKEYGVYLKPYHIVYKNSKRYIYIGKYWYKLEKIGGKLKWIYLGKTKPIQNMPNPPQIPESTIIKEDNEYIVDEKILYDLE
|
|
| PDBID: | 9efj | | Status: | HPUB -- hold until publication | | Title: | Histidine-covalent alpha-helical peptide (compound 6) targeting hMcl-1 | | Authors: | Muzzarelli, K.M., Assar, Z., Alboreggia, G., Udompholkul, P., Pellecchia, M. | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9efp | | Status: | HOLD -- hold until a certain date | | Title: | Crystal Structure of Saccharomyces cerevisiae Sec14p in complex with phosphatidylcholine | | Authors: | Green, S.M., Laganowsky, A., Krieger, I., Singh, P.K., Igumenova, T.I., Bankaitis, V.A., Sacchettini, J. | | Deposition date: | 2024-11-20 | | Release date: | 2025-11-20 |
|
| PDBID: | 9efl | | Status: | HPUB -- hold until publication | | Title: | Structure of a GH16_17 carrageenase from a metagenomic dataset. | | Authors: | Boraston, A.B., Tingley, J., Mihalynuk, L., Abbott, D.W. | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9eg5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9hgp | | Status: | HPUB -- hold until publication | | Title: | Human Carbonic Anhydrase II in complex with a synthetic aromatic oligoamide foldamer | | Authors: | Sigl, J.C., Wang, L., Huc, I. | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9hgm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9hh3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9hgn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9hh2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the family S1_19 carrageenan sulfatase ZgCgsA from Zobellia galactanivorans in complex with hybrid a-i-neocarratetraose | | Authors: | Chevenier, A., Czjzek, M., Michel, G., Ficko-Blean, E. | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9hgz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9hgo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9hgq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-20 |
|
