| PDBID: | 9nnp | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9nnq | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9nnr | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9nns | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9nnt | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9nnu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of Ebola Envelope glycoprotein GP in complex with compound LD4-189ZbR | | Authors: | Agrawal, S., Wilson, I.A. | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9nnv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | X-ray structure of CCoV-HuPn-2018 main protease bound to non-covalent inhibitor X77 at 2.15A | | Authors: | Jayashankar, U., Ghosh, A.K., Mesecar, A.D., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9nnw | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of SARS-CoV-2 main protease V186F covalently bound to inhibitor GRL-050-23 at 1.55 A | | Authors: | Beechboard, S.N., Ghosh, A.K., Mesecar, A.D., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2025-03-06 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFFDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
| PDBID: | 9nnx | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | [7,8,4-2] Shifted tensegrity triangle with an (arm,center,arm) distribution of (7,8,4) base pairs and 2 nt sticky ends | | Authors: | Abi Rizk, J., Horvath, A., Vecchioni, S., Woloszyn, K., Ohayon, Y.P., Sha, R. | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9nny | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | [4,7,8-2] Shifted tensegrity triangle with an (arm,center,arm) distribution of (4,7,8) base pairs and 2 nt sticky ends, with hexagonal symmetry | | Authors: | Abi Rizk, J., Horvath, A., Vecchioni, S., Woloszyn, K., Ohayon, Y.P., Sha, R. | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9nnz | | Status: | HPUB -- hold until publication | | Title: | A membrane protein with cofactor determined by single-particle CryoEM | | Authors: | Suder, D.S., Gonen, S. | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9no0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-07 |
|
| PDBID: | 9no1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-ET map of the VZV capsid vertex (5-fold axis). | | Authors: | Oliver, S.L., Chen, M. | | Deposition date: | 2025-03-07 | | Release date: | 2026-03-07 |
|
| PDBID: | 9no2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-07 |
|
| PDBID: | 9no3 | | Status: | HPUB -- hold until publication | | Title: | The bifunctional arabinofuranosidase/xylosidase from metagenome of Pseudacanthotermes militaris. | | Authors: | Gomes, B.M., De Oliveira, G.S., de Melo, V.S., Rossini, N.O., Dias, M.V.B., Chambergo, F.S. | | Deposition date: | 2025-03-07 |
|
| PDBID: | 9no4 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2025-03-07 |
|
| PDBID: | 9no5 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of vWFA domain from LapA adhesin of Pseudomonas fluorescens | | Authors: | Kinrade, B., Guo, S., Ye, Q., Davies, P.L. | | Deposition date: | 2025-03-07 |
|
| PDBID: | 9no6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-07 |
|
| PDBID: | 9no7 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of the wild-type Thermus thermophilus 70S ribosome in complex with mRNA, A-site Q230-N5-methylated Release Factor 1, and P-site 2''-deoxy-A76-fMEAAAKC-peptidyl-tRNAcys at 2.13A resolution | | Authors: | Aleksandrova, E.V., Syroegin, E.A., Basu, R.S., Vassilevski, A.A., Gagnon, M.G., Polikanov, Y.S. | | Deposition date: | 2025-03-08 |
|
| PDBID: | 9no8 | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of computationally designed bundlemer peptide nanotube (14 protofilament) | | Authors: | Das, A., Conticello, V.P. | | Deposition date: | 2025-03-08 |
|
| PDBID: | 9no9 | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of computationally designed bundlemer peptide nanotube (15 protofilament) | | Authors: | Das, A., Conticello, V.P. | | Deposition date: | 2025-03-08 |
|
| PDBID: | 9noa | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of unliganded Fab MS-1805 | | Authors: | Jain, M., Wilson, I.A. | | Deposition date: | 2025-03-08 |
|
| PDBID: | 9nob | | Status: | HPUB -- hold until publication | | Title: | Crystal Structutre of unliganded Fab 224 | | Authors: | Jain, M., Wilson, I.A. | | Deposition date: | 2025-03-08 |
|
| PDBID: | 9noc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-09 |
|
| PDBID: | 9nod | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | [4,3,12-2] Shifted tensegrity triangle with an (arm,center,arm) distribution of (4,3,12) base pairs and 2 nt sticky ends | | Authors: | Horvath, A., Woloszyn, K., Vecchioni, S., Ohayon, Y.P., Sha, R. | | Deposition date: | 2025-03-09 |
|
