| PDBID: | 9rij | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | EV-A71 (genotype B5) in complex with 16-2-8C Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9ec1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-13 |
|
| PDBID: | 9m1j | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the TBC-DE-Arl2-beta-tubulin complex | | Authors: | Seong, Y.J., Kim, H.M., Byun, K.M., Park, Y.W., Roh, S.H. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9rik | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | EV-A71 (genotype B5) in complex with 16-2-2D Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9ebv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-13 |
|
| PDBID: | 9m1i | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the TBC-D-Arl2-beta-tubulin complex | | Authors: | Seong, Y.J., Kim, H.M., Byun, K.M., Park, Y.W., Roh, S.H. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9ril | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | EV-A71 (genotype B5) in complex with 16-3-3C Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9ec6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-13 |
|
| PDBID: | 9m1o | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structures of NPFFR2 complex with neuropeptide FF | | Authors: | Pan, B.X., Li, X.Z., Jiang, Y. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9rim | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | EV-A71 (genotype B5) in complex with 16-3-4D Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9ec7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-13 |
|
| PDBID: | 9m1z | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of MAP2K6 complexed with 5Z-7-oxozeaenol | | Authors: | Yumura, S., Kinoshita, T. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9rio | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | EV-A71 (genotype B5) in complex with 17-2-2B Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9ec8 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-11-13 | | Release date: | 2025-11-13 |
|
| PDBID: | 9m1p | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the histamine-bound zTAAR13d-Gs complex | | Authors: | Zheng, Y., Zhao, S.W. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9rip | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | EV-A71 (genotype B5) in complex with 17-2-12A Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9ec9 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-11-13 | | Release date: | 2025-11-13 |
|
| PDBID: | 9m1v | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of N-terminal domain of hypothetical protein Rv1421 from Mycobacterium tuberculosis H37Rv in complex with uridine diphosphate N-acetyl glucosamine | | Authors: | Lee, K.S., Park, J. | | Deposition date: | 2025-02-26 | | Release date: | 2025-08-26 | | Sequence: | >Entity 1
MMNHARGVENRSEGGGIDVVLVTGLSGAGRGTAAKVLEDLGWYVADNLPPQLITRMVDFGLAAGSRITQLAVVMDVRSRGFTGDLDSVRNELATRAITPRVVFMEASDDTLVRRYEQNRRSHPLQGEQTLAEGIAAERRMLAPVRATADLIIDTSTLSVGGLRDSIERAFGGDG
|
|
| PDBID: | 9riq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | EV-A71 (genotype C4) in complex with 16-2-11B Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9eca | | Status: | HOLD -- hold until a certain date | | Title: | Intermediate state of wild-type EsCas13d ternary complex with C4A mismatch | | Authors: | Chou, C.W., Finkelstein, I.J. | | Deposition date: | 2024-11-13 | | Release date: | 2025-11-13 |
|
| PDBID: | 9m1x | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of human heart fatty acid-binding protein at 0.80 A resolution (holo-FABP3) | | Authors: | Sugiyama, S., Maekawa, S., Matsuoka, S., Murata, M. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9rir | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | EV-A71 (genotype C4) in complex with 16-3-10B Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9ecd | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-11-13 | | Release date: | 2025-11-13 |
|
| PDBID: | 9m22 | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of human heart fatty acid-binding protein delipidated with Lipidex | | Authors: | Sugiyama, S., Maekawa, S., Matsuoka, S., Murata, M. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9riw | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-11 |
|
