| PDBID: | 9n4l | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n4m | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n4n | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n4o | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n4p | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n4q | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n4r | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n4s | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n4t | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n4u | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n4x | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n59 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n5a | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n52 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n53 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n56 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n57 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9i7x | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9i7w | | Status: | HPUB -- hold until publication | | Title: | Extended and wrapped protein P7 dimers of dimers, the P1 layer and the RNA-dependent RNA polymerase P2 in transcribing particles of bacteriophage phi6 | | Authors: | Kumpula, E.-P., Ilca, S.L., Huiskonen, J.T. | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9i80 | | Status: | HPUB -- hold until publication | | Title: | LecA in complex with a tolcapone derivative glycomimetic | | Authors: | Varrot, A. | | Deposition date: | 2025-02-03 | | Sequence: | >Entity 1
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
|
|
| PDBID: | 9i7y | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of KRasG13C in Complex with Nucleotide-based Covalent Inhibitor 7b | | Authors: | Niggenaber, J., Mueller, M.P., Rauh, D. | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9i7z | | Status: | HPUB -- hold until publication | | Title: | LecA in complex with 2-fluoro non-carbohydrate glycomimetic | | Authors: | Varrot, A. | | Deposition date: | 2025-02-03 | | Sequence: | >Entity 1
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
|
|
| PDBID: | 9lrz | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-02 |
|
| PDBID: | 9ls2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-02 |
|
| PDBID: | 9lry | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-02 |
|
